KEGG   Escherichia coli K-12 MG1655: b4262Help
Entry
b4262             CDS       T00007                                 

Gene name
lptG
Definition
(RefSeq) lipopolysaccharide transport system protein LptG
  KO
K11720  lipopolysaccharide export system permease protein
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b4262 (lptG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b4262 (lptG)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    b4262 (lptG)
 Other transporters
  Pores ion channels [TC:1]
   b4262 (lptG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LptF_LptG
Motif
Other DBs
NCBI-GeneID: 945324
NCBI-ProteinID: NP_418683
Pasteur: yjgQ
RegulonDB: ECK120004384
ECOCYC: G7889
ASAP: ABE-0013960
UniProt: P0ADC6
Structure
PDB: 

Position
4487318..4488400
Genome map
AA seq 360 aa AA seqDB search
MQPFGVLDRYIGKTIFTTIMMTLFMLVSLSGIIKFVDQLKKAGQGSYDALGAGMYTLLSV
PKDVQIFFPMAALLGALLGLGMLAQRSELVVMQASGFTRMQVALSVMKTAIPLVLLTMAI
GEWVAPQGEQMARNYRAQAMYGGSLLSTQQGLWAKDGNNFVYIERVKGDEELGGISIYAF
NENRRLQSVRYAATAKFDPEHKVWRLSQVDESDLTNPKQITGSQTVSGTWKTNLTPDKLG
VVALDPDALSISGLHNYVKYLKSSGQDAGRYQLNMWSKIFQPLSVAVMMLMALSFIFGPL
RSVPMGVRVVTGISFGFVFYVLDQIFGPLTLVYGIPPIIGALLPSASFFLISLWLLMRKS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccttttggcgtacttgaccgctatatcggtaaaactattttcaccaccatcatg
atgacactgttcatgctggtgtcgctgtcgggcattatcaagtttgtcgatcagctgaaa
aaagccgggcaggggagttacgacgcgttaggcgcaggaatgtataccttgctgagcgtg
ccgaaagatgtgcagatcttcttcccgatggcggctctgcttggggcgttgcttggtctt
gggatgctggcgcagcgcagcgaactggtggtgatgcaggcttctggttttacccgtatg
caggtggcgctgtcggtgatgaaaaccgccattccgctggtcttgctgacgatggcgatt
ggcgaatgggtcgcgccgcagggcgagcagatggcgcgtaactaccgtgcgcaggcgatg
tacggcggctcgttgctctctacccagcaaggcttatgggcgaaagatggcaacaacttc
gtctacattgagcgggttaaaggtgacgaagagttaggtggcatcagcatttatgccttt
aacgagaatcgtcgtctgcaatccgtacgctatgccgctactgcgaagtttgacccggaa
cataaagtctggcgtctgtcgcaggttgatgaatctgatctgaccaatccgaaacagatt
accggttcgcagacggtgagcggcacctggaaaaccaacctcacgccggacaaactgggc
gtggtggcgctggacccggatgcactctctatcagcggtttgcacaactatgtgaagtat
ctgaagtcgagcggtcaggatgccggacgttatcagctcaacatgtggagcaaaatcttc
cagccgctatctgtggcggtgatgatgctgatggcgctgtcgttcatctttggcccactg
cgtagcgtaccgatgggcgtgcgtgtggtcaccggtatcagtttcggttttgtcttctac
gtactggaccagatcttcggcccgctgacgttggtttatggcatcccgccgatcatcggc
gcactgttgccaagcgccagcttcttcttaatcagcctgtggctgttaatgagaaaatcg
taa

DBGET integrated database retrieval system