KEGG   Escherichia coli K-12 MG1655: b4266Help
Entry
b4266             CDS       T00007                                 

Gene name
idnO
Definition
(RefSeq) 5-keto-D-gluconate 5-reductase
  KO
K00046  gluconate 5-dehydrogenase [EC:1.1.1.69]
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    b4266 (idnO)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.69  gluconate 5-dehydrogenase
     b4266 (idnO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR DUF1776 DUF5405
Motif
Other DBs
NCBI-GeneID: 947109
NCBI-ProteinID: NP_418687
Pasteur: idnO
RegulonDB: ECK120004387
ECOCYC: G7892
ASAP: ABE-0013971
UniProt: P0A9P9
Position
complement(4492587..4493351)
Genome map
AA seq 254 aa AA seqDB search
MNDLFSLAGKNILITGSAQGIGFLLATGLGKYGAQIIINDITAERAELAVEKLHQEGIQA
VAAPFNVTHKHEIDAAVEHIEKDIGPIDVLVNNAGIQRRHPFTEFPEQEWNDVIAVNQTA
VFLVSQAVTRHMVERKAGKVINICSMQSELGRDTITPYAASKGAVKMLTRGMCVELARHN
IQVNGIAPGYFKTEMTKALVEDEAFTAWLCKRTPAARWGDPQELIGAAVFLSSKASDFVN
GHLLFVDGGMLVAV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatctattttcactggcaggaaaaaatatcttgattaccggttcagcacagggc
attggctttttactggcaaccggcctgggtaaatatggcgcacaaataattattaatgat
attactgccgaacgcgcagaacttgctgtagaaaaactccaccaggagggtattcaggcc
gttgccgcaccttttaatgttactcataaacatgaaattgatgccgccgttgaacatatc
gaaaaggacatcggccccattgatgtgctggtgaataacgccggtatccagcgccgtcat
ccttttactgagttccctgaacaagagtggaatgatgtgatcgcagtaaaccagaccgcc
gtgttcctggtatcgcaagcggtaactcgtcacatggttgaacgcaaggcaggtaaagtt
attaatatttgctcgatgcaaagcgaactgggacgtgacaccatcaccccttatgccgca
tcgaaaggggcggtaaaaatgctcacccgcggcatgtgcgtcgagctggcgcgccacaat
attcaggtcaacggtattgcgccgggctatttcaaaacagaaatgactaaagcactggtt
gaggacgaagccttcaccgcctggttgtgcaaacggacccccgccgcacgctggggagat
ccgcaggaactgattggtgctgcggtgttcctttcttcaaaagcctctgatttcgtaaac
ggccacctgttgtttgttgatggcggcatgttagtggctgtttaa

DBGET integrated database retrieval system