KEGG   Escherichia coli K-12 MG1655: b4273Help
Entry
b4273             CDS       T00007                                 

Gene name
insD-6
Definition
(RefSeq) KpLE2 phage-like element; IS2 insertion element protein InsB
  KO
K07497  putative transposase
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    b4273 (insD-6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: rve rve_3 HTH_21
Motif
Other DBs
NCBI-GeneID: 948779
NCBI-ProteinID: NP_418693
RegulonDB: ECK120004390
ASAP: ABE-0014001
UniProt: P0CF53 P0CF54 P0CF55 P0CF56 P0CF57 P0CF58
Position
4498595..4499500
Genome map
AA seq 301 aa AA seqDB search
MDSARALIARGWGVSLVSRCLRVSRAQLHVILRRTDDWMDGRRSRHTDDTDVLLRIHHVI
GELPTYGYRRVWALLRRQAELDGMPAINAKRVYRIMRQNALLLERKPAVPPSKRAHTGRV
AVKESNQRWCSDGFEFCCDNGERLRVTFALDCCDREALHWAVTTGGFNSETVQDVMLGAV
ERRFGNDLPSSPVEWLTDNGSCYRANETRQFARMLGLEPKNTAVRSPESNGIAESFVKTI
KRDYISIMPKPDGLTAAKNLAEAFEHYNEWHPHSALGYRSPREYLRQRACNGLSDNRCLE
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtggatagcgcacgcgcccttattgcccggggatggggagtaagcttagtcagccgttgt
ctccgggtgtcgcgtgcgcagttgcacgtcattctcagacgaaccgatgactggatggat
ggccgccgcagtcgtcacactgatgatacggatgtgcttctccgtatacaccatgttatc
ggagagctgccaacgtatggttatcgtcgggtatgggcgctgcttcgcagacaggcagaa
cttgatggtatgcctgcgatcaatgccaaacgtgtttaccggatcatgcgccagaatgcg
ctgttgcttgagcgaaaacctgctgtaccgccatcgaaacgggcacatacaggcagagtg
gccgtgaaagaaagcaatcagcgatggtgctctgacgggttcgagttctgctgtgataac
ggagagagactgcgtgtcacgttcgcgctggactgctgtgatcgtgaggcactgcactgg
gcggtcactaccggcggcttcaacagtgaaacagtacaggacgtcatgctgggagcggtg
gaacgccgcttcggcaacgatcttccgtcgtctccagtggagtggctgacggataatggt
tcatgctaccgggctaatgaaacacgccagttcgcccggatgttgggacttgaaccgaag
aacacggcggtgcggagtccggagagtaacggaatagcagagagcttcgtgaaaacgata
aagcgtgactacatcagtatcatgcccaaaccagacgggttaacggcagcaaagaacctt
gcagaggcgttcgagcattataacgaatggcatccgcatagtgcgctgggttatcgctcg
ccacgggaatatctgcggcagcgggcttgtaatgggttaagtgataacagatgtctggaa
atatag

DBGET integrated database retrieval system