KEGG   Escherichia coli K-12 MG1655: b4325
Entry
b4325             CDS       T00007                                 

Gene name
yjiC
Definition
(RefSeq) uncharacterized protein YjiC
Organism
eco  Escherichia coli K-12 MG1655
SSDB
Motif
Pfam: DUF2686
Other DBs
NCBI-GeneID: 948850
NCBI-ProteinID: NP_418745
Pasteur: yjiC
RegulonDB: ECK120004417
ECOCYC: G7922
ASAP: ABE-0014181
UniProt: P39374
Position
complement(4555490..4556320)
AA seq 276 aa
MSMPLSNALQSQIITDAHFLHHPIVDSEFTRKLKYARMDSENIYLPPLTRGNNHNYDGKS
VVEIRKLDISKEPWPFNYVTGACRESDGITTTGRMLYRNLKITSALDEIYGGICKKAHAT
TELAEGLRLNLFMKSPFDPVEDYTVHEITLGPGCNVPGYAGTTIGYISTLPASQAKRWTN
EQPRIDIYIDQIMTVTGVANSSGFALAALLNANIELGNDPIIGIEAYPGTAEIHAKMGYK
VIPGDENAPLKRMTLQPSSLPELFELKNGEWNYIGK
NT seq 831 nt   +upstreamnt  +downstreamnt
atgtctatgccattaagcaatgcccttcagagtcaaattattacagatgctcacttcctt
catcacccaatagtcgacagtgagtttacacgtaaattaaaatatgcacgcatggattcg
gaaaacatctatcttccgcctcttactcgtggcaataaccataattacgatggaaaaagc
gttgtcgaaattagaaaacttgatattagtaaagagccttggccatttaattatgtgaca
ggagcatgcagagaatccgatggtattacaacaacaggacgtatgctctatcggaacttg
aaaatcacctcagctttagacgaaatatatggtggcatatgtaaaaaggcgcatgctacc
acagagttagcagaaggtttacggctaaatttatttatgaagagccctttcgatcctgtt
gaggactatacagttcatgaaataacattaggccctggttgcaatgttcctggttatgcc
ggaaccacgataggatatatttcaacccttccagcttctcaggcaaaaagatggaccaat
gagcagccaaggattgatatctatattgatcagataatgacggtaacaggggtagcaaat
tcttccggattcgcccttgccgcattacttaatgctaatattgagttgggtaatgaccca
ataattggtatagaagcctatcccggtaccgcggagatccatgcaaaaatgggatataaa
gttatcccgggtgatgaaaatgcaccactcaaacgtatgactctgcaaccgtcatctctt
ccagaactgtttgaattaaaaaatggtgaatggaattatattggtaaataa

DBGET integrated database retrieval system