KEGG   Escherichia coli K-12 MG1655: b4337Help
Entry
b4337             CDS       T00007                                 

Gene name
mdtM
Definition
(RefSeq) multidrug efflux pump/bile salt:H(+) antiporter/Na(+):H(+) antiporter/K(+):H(+) antiporter
  KO
K23241  MFS transporter, DHA1 family, multidrug resistance protein
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b4337 (mdtM)
Transporters [BR:eco02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    b4337 (mdtM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-GeneID: 948861
NCBI-ProteinID: NP_418757
Pasteur: yjiO
RegulonDB: ECK120002324
ECOCYC: EG12576
ASAP: ABE-0014221
UniProt: P39386 A0A387D0R5
Position
complement(4567287..4568519)
Genome map
AA seq 410 aa AA seqDB search
MPRFFTRHAATLFFPMALILYDFAAYLSTDLIQPGIINVVRDFNADVSLAPAAVSLYLAG
GMALQWLLGPLSDRIGRRPVLITGALIFTLACAATMFTTSMTQFLIARAIQGTSICFIAT
VGYVTVQEAFGQTKGIKLMAIITSIVLIAPIIGPLSGAALMHFMHWKVLFAIIAVMGFIS
FVGLLLAMPETVKRGAVPFSAKSVLRDFRNVFCNRLFLFGAATISLSYIPMMSWVAVSPV
ILIDAGSLTTSQFAWTQVPVFGAVIVANAIVARFVKDPTEPRFIWRAVPIQLVGLSLLIV
GNLLSPHVWLWSVLGTSLYAFGIGLIFPTLFRFTLFSNKLPKGTVSASLNMVILMVMSVS
VEIGRWLWFNGGRLPFHLLAVVAGVIVVFTLAGLLNRVRQHQAAELVEEQ
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgccacgtttttttacccgccatgccgccacgctgtttttcccgatggcgttgattttg
tatgactttgctgcgtatctgtcgacggatctgatccagcctgggatcattaatgtggta
cgtgattttaatgccgatgtcagtctggcccctgctgccgtcagtctctatcttgctggc
ggtatggcgttacagtggctgctggggccgctttccgacagaattggccgcaggccggtg
ctgattaccggggcgctaatttttacccttgcctgcgccgcgacaatgttcacaacgtct
atgacacagtttcttatcgcgcgtgcaattcagggcaccagtatctgttttattgccacc
gttggttatgtcacggtgcaggaggcgttcggacagacaaaagggatcaagttgatggcg
attatcacctccatcgtactgattgcgccgattatcggcccgctttccggcgcagctctg
atgcactttatgcactggaaagtcctttttgccatcattgcggttatgggttttatctca
tttgttggcttactgttggcgatgccagagacggtgaagcgcggcgcggttccgtttagc
gccaaaagcgtcttgcgcgattttcgtaatgtcttttgcaatcggctgttcctctttggc
gcagcaaccatctctttaagctatatcccgatgatgagctgggtggctgtctcgccggtg
atccttatcgatgcaggcagcttaacaacttcgcagttcgcctggacacaggttccggtg
ttcggcgcggtgattgttgcgaatgccatcgtggcgcgttttgttaaagatccgaccgaa
ccgcggtttatctggcgtgccgtacccattcaactggtcggcctctcgctgttgattgtc
ggcaatctgctgtcgccgcacgtctggctgtggtcggtgctgggcaccagtctgtatgct
ttcgggattggtttgattttcccgaccttattccgctttacgctgttttccaataagtta
ccgaaagggaccgtctccgcatcgctaaatatggtgatcctgatggtgatgtcggtctcg
gtcgaaatcggccgctggctatggtttaacggcggtcgcttgccgtttcatctgttagcc
gttgtggcgggcgttatcgtcgttttcaccctggcgggattgctcaatcgcgtgcgccag
catcaggcagccgagctagtggaggagcagtga

DBGET integrated database retrieval system