KEGG   Escherichia coli K-12 MG1655: b4361Help
Entry
b4361             CDS       T00007                                 

Gene name
dnaC
Definition
(RefSeq) DNA replication protein DnaC
  KO
K02315  DNA replication protein DnaC
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:eco03032]
    b4361 (dnaC)
DNA replication proteins [BR:eco03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    b4361 (dnaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IstB_IS21 AAA Bac_DnaA ArsA_ATPase RNA_helicase CbiA ResIII ATPase PIF1 RuvB_N AAA_11 AAA_30 PhoH Sigma54_activat AAA_33 MeaB Torsin Mg_chelatase
Motif
Other DBs
NCBI-GeneID: 948864
NCBI-ProteinID: NP_418781
Pasteur: dnaC
RegulonDB: ECK120000231
ECOCYC: EG10237
ASAP: ABE-0014304
UniProt: P0AEF0
Structure
PDB: 

Position
complement(4600238..4600975)
Genome map
AA seq 245 aa AA seqDB search
MKNVGDLMQRLQKMMPAHIKPAFKTGEELLAWQKEQGAIRSAALERENRAMKMQRTFNRS
GIRPLHQNCSFENYRVECEGQMNALSKARQYVEEFDGNIASFIFSGKPGTGKNHLAAAIC
NELLLRGKSVLIITVADIMSAMKDTFRNSGTSEEQLLNDLSNVDLLVIDEIGVQTESKYE
KVIINQIVDRRSSSKRPTGMLTNSNMEEMTKLLGERVMDRMRLGNSLWVIFNWDSYRSRV
TGKEY
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgttggcgacctgatgcaacgcctgcaaaaaatgatgcctgcccatatcaaa
cccgcattcaaaacgggtgaagaactactggcctggcaaaaagaacaaggagcgatccgc
tccgccgctctcgaacgtgaaaatcgggcgatgaaaatgcagcgcacctttaaccgctcc
ggtattcgtccactgcatcagaactgttcctttgagaactatcgcgttgagtgtgaaggg
cagatgaatgcgttaagcaaagcgcgccagtatgtcgaagagtttgacggcaacatcgcc
agcttcatcttttctggtaagccaggaaccggcaaaaaccatctggcggcggcaatctgc
aacgagctgctgctacgcggtaaatccgtattgatcatcaccgtggccgatattatgtcg
gcgatgaaagataccttcaggaatagcggtaccagcgaagaacaactgcttaacgatctg
agcaacgttgatctgctggtgatcgatgagatcggcgtgcagaccgaatcgaaatacgaa
aaagtgatcatcaaccagatcgtcgatcgccgctcttcttccaaacgcccaaccgggatg
ctgaccaacagtaatatggaagagatgaccaagttgctgggcgaacgcgtgatggaccgt
atgcgcctgggtaacagtttgtgggtgatcttcaactgggatagctaccgtagccgggta
acaggtaaagagtattaa

DBGET integrated database retrieval system