KEGG   Escherichia coli K-12 MG1655: b4372Help
Entry
b4372             CDS       T00007                                 

Gene name
holD
Definition
(RefSeq) DNA polymerase III, psi subunit
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00230  Purine metabolism
eco00240  Pyrimidine metabolism
eco01100  Metabolic pathways
eco03030  DNA replication
eco03430  Mismatch repair
eco03440  Homologous recombination
Module
eco_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    b4372 (holD)
   00240 Pyrimidine metabolism
    b4372 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    b4372 (holD)
   03430 Mismatch repair
    b4372 (holD)
   03440 Homologous recombination
    b4372 (holD)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     b4372 (holD)
DNA replication proteins [BR:eco03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     b4372 (holD)
DNA repair and recombination proteins [BR:eco03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     b4372 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi CSTF_C
Motif
Other DBs
NCBI-GeneID: 948890
NCBI-ProteinID: NP_418789
Pasteur: holD
RegulonDB: ECK120001380
ECOCYC: EG11414
ASAP: ABE-0014340
UniProt: P28632
Structure
PDB: 

Position
4607803..4608216
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWSLRRPGALQGEIAIAIPAHVRLVMVANDLPALTDPLVSDVLRA
LTVSPDQVLQLTPEKIAMLPQGSHCNSWRLGTDEPLSLEGAQVASPALTDLRANPTARAA
LWQQICTYEHDFFPRND
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggcattacccagtggtcgctgcgt
cgccctggcgcgttgcagggggagattgccattgcgatcccggcacacgtccgtctggtg
atggtggcaaacgatcttcccgccctgactgatcctttagtgagcgatgttctgcgcgca
ttaaccgtcagccccgaccaggtgctgcaactgacgccagaaaaaatcgcgatgctgccg
caaggcagtcactgcaacagttggcggttgggtactgacgaaccgctatcactggaaggc
gctcaggtggcatcaccggcgctcaccgatttacgggcaaacccaacggcacgcgccgcg
ttatggcaacaaatttgcacatatgaacacgatttcttccctcgaaacgactga

DBGET integrated database retrieval system