KEGG   Escherichia coli K-12 MG1655: b4393Help
Entry
b4393             CDS       T00007                                 

Gene name
trpR
Definition
(RefSeq) transcriptional repressor, tryptophan-binding
  KO
K03720  TrpR family transcriptional regulator, trp operon repressor
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eco03000]
    b4393 (trpR)
Transcription factors [BR:eco03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    b4393 (trpR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_repressor HTH_5
Motif
Other DBs
NCBI-GeneID: 948917
NCBI-ProteinID: NP_418810
Pasteur: trpR
RegulonDB: ECK120001018
ECOCYC: EG11029
ASAP: ABE-0014408
UniProt: P0A881
Structure
PDB: 

Position
4632760..4633086
Genome map
AA seq 108 aa AA seqDB search
MAQQSPYSAAMAEQRHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGTRVRIVEE
LLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLEEVLLKSD
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggcccaacaatcaccctattcagcagcgatggcagaacagcgtcaccaggagtggtta
cgttttgtcgacctgcttaagaatgcctaccaaaacgatctccatttaccgttgttaaac
ctgatgctgacgccagatgagcgcgaagcgttggggactcgcgtgcgtattgtcgaagag
ctgttgcgcggcgaaatgagccagcgtgagttaaaaaatgaactcggcgcaggcatcgcg
acgattacgcgtggatctaacagcctgaaagccgcgcccgtcgagctgcgccagtggctg
gaagaggtgttgctgaaaagcgattga

DBGET integrated database retrieval system