KEGG   Escherichia coli K-12 MG1655: b4411
Entry
b4411             CDS       T00007                                 
Symbol
ecnB
Name
(RefSeq) bacteriolytic entericidin B lipoprotein
  KO
K16348  entericidin B
Organism
eco  Escherichia coli K-12 MG1655
Brite
KEGG Orthology (KO) [BR:eco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b4411 (ecnB)
Transporters [BR:eco02000]
 Other transporters
  Others
   b4411 (ecnB)
SSDB
Motif
Pfam: Entericidin LPAM_1
Other DBs
NCBI-GeneID: 2847737
NCBI-ProteinID: YP_026284
Pasteur: ecnB
RegulonDB: ECK120002651
ECOCYC: G0-9562
ASAP: ABE-0047211
UniProt: P0ADB7
Position
4376553..4376699
AA seq 48 aa
MVKKTIAAIFSVLVLSTVLTACNTTRGVGEDISDGGNAISGAATKAQQ
NT seq 147 nt   +upstreamnt  +downstreamnt
atggtgaagaagacaattgcagcgatcttttctgttctggtgctttcaacagtattaact
gcctgcaacaccacgcgtggcgttggtgaagacatttctgatggcggtaacgcgatttct
ggcgcagcaacgaaagcgcagcaataa

DBGET integrated database retrieval system