KEGG   Escherichia coli K-12 MG1655: b4470Help
Entry
b4470             CDS       T00007                                 

Gene name
yhaM
Definition
(RefSeq) putative L-serine dehydratase alpha chain
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SDH_alpha Copper-fist
Motif
Other DBs
NCBI-GeneID: 2847723
NCBI-ProteinID: YP_026202
RegulonDB: ECK120004175
ECOCYC: G7622
ASAP: ABE-0174100
UniProt: P42626
Position
complement(3255341..3256651)
Genome map
AA seq 436 aa AA seqDB search
MFDSTLNPLWQRYILAVQEEVKPALGCTEPISLALAAAVAAAELEGPVERVEAWVSPNLM
KNGLGVTVPGTGMVGLPIAAALGALGGNANAGLEVLKDATAQAIADAKALLAAGKVSVKI
QEPCDEILFSRAKVWNGEKWACVTIVGGHTNIVHIETHDGVVFTQQACVAEGEQESPLTV
LSRTTLAEILKFVNEVPFAAIRFILDSAKLNCALSQEGLSGKWGLHIGATLEKQCERGLL
AKDLSSSIVIRTSAASDARMGGATLPAMSNSGSGNQGITATMPVVVVAEHFGADDERLAR
ALMLSHLSAIYIHNQLPRLSALCAATTAAMGAAAGMAWLVDGRYETISMAISSMIGDVSG
MICDGASNSCAMKVSTSASAAWKAVLMALDDTAVTGNEGIVAHDVEQSIANLCALASHSM
QQTDRQIIEIMASKAR
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtttgattcgactttaaatccgttatggcagcgttacatcctcgccgttcaggaggaa
gtaaaaccggcgctgggatgtactgaaccgatttcactggcgctggcggcggcggttgct
gcggcagaactggaaggtccggttgaacgtgtagaagcctgggtttcgccaaatctgatg
aagaacggtctgggcgtcaccgttcccggcacgggaatggtggggctgccgattgcggcg
gcgctgggggcgttaggtggaaatgccaacgccgggctggaagtgctgaaagacgcaaca
gcgcaggcaattgccgatgccaaagcactgctggcggcggggaaagtctccgttaagatc
caggaaccttgcgatgaaatcctcttctcacgcgccaaagtctggaacggtgagaagtgg
gcgtgtgtcaccatcgtcggcgggcataccaacattgtgcatatcgagacgcacgatggt
gtggtgtttacccagcaggcgtgtgtggcagagggcgagcaagagtctccgctgacggtg
ctttccagaacgacgctggctgagatcctgaagttcgtcaatgaagtcccgtttgcggcg
atccgctttattctcgattccgcgaagctaaattgtgcgttatcgcaggaaggtttgagc
ggtaagtgggggctgcatattggcgcgacgctggaaaaacagtgcgagcgcggtttgctg
gcgaaagatctctcttcatccattgtgattcgtaccagcgcggcatccgatgcgcgtatg
ggcggcgctacgcttccggctatgagtaactccggctcgggtaaccaggggattaccgca
acaatgcctgtggtggtggtagcagaacacttcggagcggatgatgaacggctggcgcgt
gcgctgatgctttcgcatttgagcgcaatttacatccataaccagttaccgcgtttgtct
gcgctgtgtgccgcaacgaccgcagcaatgggggccgccgccgggatggcatggctggtg
gatgggcgttatgaaaccatctcgatggcgatcagcagtatgatcggcgatgtcagcggc
atgatttgcgatggtgcgtcgaacagctgcgcgatgaaggtttcgaccagtgcttcggct
gcgtggaaagcggtgttaatggcgctggatgataccgccgtgaccggcaatgaagggatt
gtggcgcatgatgttgagcagtcgattgccaacctgtgtgcgttagcaagccattcgatg
cagcaaacggatcggcagattatcgagattatggcgagcaaggccagataa

DBGET integrated database retrieval system