KEGG   Escherichia coli K-12 MG1655: b4485Help
Entry
b4485             CDS       T00007                                 

Gene name
ytfR
Definition
(RefSeq) galactofuranose ABC transporter putative ATP binding subunit
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    b4485 (ytfR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b4485 (ytfR)
Enzymes [BR:eco01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     b4485 (ytfR)
Transporters [BR:eco02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    b4485 (ytfR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_30 AAA_16 ABC_ATPase AAA_23 RsgA_GTPase AAA_22 MMR_HSR1 AAA_15 DUF2813 TsaE DUF815 DLIC FeoB_N
Motif
Other DBs
NCBI-GeneID: 2847725
NCBI-ProteinID: YP_026286
RegulonDB: ECK120002313
ECOCYC: EG12518
ASAP: ABE-0174118
UniProt: Q6BEX0
Position
4451058..4452560
Genome map
AA seq 500 aa AA seqDB search
MTTDQHQEILRTEGLSKFFPGVKALDNVDFSLRRGEIMALLGENGAGKSTLIKALTGVYH
ADRGTIWLEGQAISPKNTAHAQQLGIGTVYQEVNLLPNMSVADNLFIGREPKRFGLLRRK
EMEKRATELMASYGFSLDVREPLNRFSVAMQQIVAICRAIDLSAKVLILDEPTASLDTQE
VELLFDLMRQLRDRGVSLIFVTHFLDQVYQVSDRITVLRNGSFVGCRETCELPQIELVKM
MLGRELDTHALQRAGRTLLSDKPVAAFKNYGKKGTIAPFDLEVRPGEIVGLAGLLGSGRT
ETAEVIFGIKPADSGTALIKGKPQNLRSPHQASVLGIGFCPEDRKTDGIIAAASVRENII
LALQAQRGWLRPISRKEQQEIAERFIRQLGIRTPSTEQPIEFLSGGNQQKVLLSRWLLTR
PQFLILDEPTRGIDVGAHAEIIRLIETLCADGLALLVISSELEELVGYADRVIIMRDRKQ
VAEIPLAELSVPAIMNAIAA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccgaccaacaccaggagatcctccgcaccgaaggattaagtaaatttttcccc
ggcgtcaaagcgttagacaacgttgatttcagcctgcgccgtggcgaaatcatggcgctg
ctcggtgaaaacggggcgggaaaatcaacgctaatcaaagcattaactggtgtataccac
gccgatcgcggcaccatctggctggaaggccaggctatctcaccgaaaaataccgcccac
gcgcaacaactcggcattggcaccgtctatcaggaagtcaacctgctacccaatatgtcg
gtcgctgataatctatttataggccgcgaacccaaacgcttcggccttctacgccgcaaa
gagatggaaaagcgcgccaccgaactgatggcatcttacggtttctccctcgacgtgcgc
gaaccgctcaaccgcttttcagtcgcgatgcagcaaatcgtcgctatttgtcgggctatc
gatctctctgccaaagtgctgatcctcgatgaacccaccgccagtctcgacacccaggaa
gtggagttactgtttgacctgatgcgtcagttgcgcgatcgcggcgtcagcctgattttt
gtcactcactttctcgatcaggtctatcaggtcagcgatcggatcaccgtcttacgcaac
ggcagtttcgtaggctgtcgggaaacgtgcgagctaccgcagatcgaactggtaaaaatg
atgctggggcgcgagctggatacccacgcgctacagcgtgccgggcgaacattgttgagc
gacaaacccgttgccgcgttcaaaaattacggcaaaaaaggaacgatcgcaccgtttgat
ctcgaagtacgccccggcgagatcgtcggtctggctggattgctgggatcaggacgtacc
gaaaccgccgaagtgatcttcggtatcaaacctgctgacagcggcacggcgttgatcaaa
ggcaaaccgcaaaacctgcgatcgccacatcaggcttcggtactgggcattggcttctgc
ccggaagacaggaaaaccgatggcatcatcgctgccgcctcggtgcgggaaaatatcatc
ctcgctctccaggcccagcgcggctggctacgtcccatttcccgcaaagaacagcaagag
attgccgaacgctttatccgccagcttggcattcgcacaccttcaactgaacaaccgatt
gaatttctctccggcggcaatcagcaaaaagtgttgctttcacgttggctactgacccga
ccgcaatttctgatcctcgatgagccaacccgcggcattgatgttggtgcccacgccgag
atcatccgcctgattgaaacgctatgcgccgatggtctggcgctgctggtgatctcctcc
gaactggaagagctggtgggctatgccgatcgggtgattatcatgcgcgatcgcaaacag
gtggcggagatcccgctggcagagctttccgttccggcgatcatgaacgccattgcggcg
taa

DBGET integrated database retrieval system