KEGG   Escherichia coli K-12 MG1655: b4565Help
Entry
b4565             CDS       T00007                                 

Gene name
sgcB
Definition
(RefSeq) putative enzyme IIB component of PTS
  KO
K02774  PTS system, galactitol-specific IIB component [EC:2.7.1.200]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00052  Galactose metabolism
eco01100  Metabolic pathways
eco02060  Phosphotransferase system (PTS)
Module
eco_M00279  PTS system, galactitol-specific II component
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    b4565 (sgcB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    b4565 (sgcB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eco02000]
    b4565 (sgcB)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.200  protein-Npi-phosphohistidine---galactitol phosphotransferase
     b4565 (sgcB)
Transporters [BR:eco02000]
 Phosphotransferase System (PTS)
  Enzyme II [TC:4.A]
   Galactitol-specific II component [MD:M00279]
    b4565 (sgcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_IIB
Motif
Other DBs
NCBI-GeneID: 1450295
NCBI-ProteinID: YP_588476
Pasteur: sgcB
RegulonDB: ECK120015144
ECOCYC: G0-10241
ASAP: ABE-0285086
UniProt: P58035
Position
complement(4530255..4530533)
Genome map
AA seq 92 aa AA seqDB search
MKKILVACGTGMSTSTMIAHKLQEFLTEQGISATTAQCCLNEIPLNCNGMDLIVTSMRTN
SDYGIPTLNGAALLTGINDDALKQQIKALLTQ
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatccttgtggcatgcggtaccggcatgtcgacttcaaccatgattgcacac
aagctgcaagagttcctgactgaacagggcatttcagccactaccgcccaatgctgtctg
aatgagatccctcttaactgtaacggtatggaccttattgtaacctccatgcgaaccaac
agtgattacggcatccctacgcttaatggcgccgccctgctcacagggatcaacgacgac
gcgttaaaacaacaaatcaaggctctgttaactcaataa

DBGET integrated database retrieval system