KEGG   Escherichia coli K-12 MG1655: b4567
Entry
b4567             CDS       T00007                                 

Gene name
yjjZ
Definition
(RefSeq) protein YjjZ
Organism
eco  Escherichia coli K-12 MG1655
SSDB
Motif
Pfam: DUF1435
Other DBs
NCBI-GeneID: 1450313
NCBI-ProteinID: YP_588478
Pasteur: yjjZ
RegulonDB: ECK120016326
ECOCYC: G0-10474
ASAP: ABE-0285088
UniProt: P55914
Position
4605804..4606040
AA seq 78 aa
MLQRTLGSGWGVLLPGLLIAGLMYADLSSDQWRIVILMGLVLTPMMLYHKQLRHYILLPS
CLALIAGIMLMIMNLNQG
NT seq 237 nt   +upstreamnt  +downstreamnt
atgttgcaacgtacgctgggcagtggctggggagtgttgctgccgggattgctgattgca
gggctgatgtatgcggatttatcgtcagatcagtggcggattgtcattctgatgggatta
gtattgacgccgatgatgctgtatcacaaacagttgcggcattacattttgctaccatcg
tgcctggcacttattgctggcatcatgctgatgataatgaatttgaatcagggatga

DBGET integrated database retrieval system