KEGG   Escherichia coli APEC O78: APECO78_00380Help
Entry
APECO78_00380     CDS       T02445                                 

Gene name
glpX
Definition
(GenBank) fructose 1,6-bisphosphatase II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
ecoa  Escherichia coli APEC O78
Pathway
ecoa00010  Glycolysis / Gluconeogenesis
ecoa00030  Pentose phosphate pathway
ecoa00051  Fructose and mannose metabolism
ecoa00680  Methane metabolism
ecoa01100  Metabolic pathways
ecoa01110  Biosynthesis of secondary metabolites
ecoa01120  Microbial metabolism in diverse environments
ecoa01130  Biosynthesis of antibiotics
ecoa01200  Carbon metabolism
Module
ecoa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecoa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APECO78_00380 (glpX)
   00030 Pentose phosphate pathway
    APECO78_00380 (glpX)
   00051 Fructose and mannose metabolism
    APECO78_00380 (glpX)
  09102 Energy metabolism
   00680 Methane metabolism
    APECO78_00380 (glpX)
Enzymes [BR:ecoa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     APECO78_00380 (glpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: AGC84818
Structure
PDB: 

Position
complement(73311..74321)
Genome map
AA seq 336 aa AA seqDB search
MRRELAIEFSRVTESAALAGYKWLGRGDKNTADGAAVNAMRIMLNQVNIDGTIVIGEGEI
DEAPMLYIGEKVGTGRGDAVDIAVDPIEGTRMTAMGQANALAVLAVGDKGCFLNAPDMYM
EKLIVGPGAKGTIDLNLPLADNLRNVAAALGKPLSELTVTILAKPRHDAVIAEMQQLGVR
VFAIPDGDVAASILTCMPDSEVDVLYGIGGAPEGVVSAAVIRALDGDMNGRLLARHDVKG
DNEENRRIGEQELARCKAMGIEAGKVLRLGDMARSDNVIFSATGITKGDLLEGISRKGNI
ATTETLLIRGKSRTIRRIQSIHYLDRKDPEMQVHIL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagacgagaacttgccatcgaattttcccgcgtcaccgaatcagcggcgctggctggc
tacaaatggttaggacgcggcgataaaaacaccgcggacggcgcggcggtaaacgccatg
cgtattatgctcaaccaggtcaacattgacggcaccatcgtcattggtgaaggtgaaatc
gacgaagcaccgatgctctacattggtgaaaaagtcggtactggtcgcggcgacgcggta
gatattgctgttgatccgattgaaggcacgcgcatgacggcgatgggccaggctaacgcg
ctggcggtgctggcagtaggcgataaaggctgcttcctcaatgcgccggatatgtatatg
gagaagctgattgtcgggccgggagccaaaggcaccattgatctgaacctgccgctggcg
gataacctgcgcaatgtagcggcggcgctcggcaaaccgttgagcgaactgacggtaacg
attctggctaaaccacgccacgatgccgttatcgctgaaatgcagcaactcggcgtacgc
gtatttgctattccggacggcgacgttgcggcctcaattctcacctgtatgccagacagc
gaagttgacgtgctgtacggtattggtggcgcgccggaaggcgtagtttctgcggcggtg
atccgcgcattagatggcgacatgaacggtcgtctgctggcgcgtcatgacgtcaaaggc
gacaacgaagagaatcgtcgcattggcgagcaggagctggcacgctgcaaagcgatgggc
atcgaagccggtaaagtattgcgcctgggcgatatggcgcgcagcgataacgtcatcttc
tctgccaccggtattaccaaaggcgatctgctggaaggcattagccgcaaaggcaatatc
gcgactaccgaaacgctgctgatccgcggcaagtcacgcaccattcgccgcattcagtcc
atccactatctggatcgcaaagacccggaaatgcaggtgcacatcctctga

DBGET integrated database retrieval system