KEGG   Escherichia coli APEC O78: APECO78_10190Help
Entry
APECO78_10190     CDS       T02445                                 

Definition
(GenBank) hypothetical protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
ecoa  Escherichia coli APEC O78
Brite
KEGG Orthology (KO) [BR:ecoa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    APECO78_10190
Enzymes [BR:ecoa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     APECO78_10190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AGC86767
Position
2092154..2093035
Genome map
AA seq 293 aa AA seqDB search
MSDTNYAVIYDLHSHTTASDGCLTPEALVHRAVEMRVGTLAITDHDTTAAIAPAREEISR
SGLALNLIPGVEISTVWENHEIHIVGLNIDITHPLMCEFLAQQTERRNQRAQLIAERLEK
AQIPGALEGAQRLAQGGAVTRGHFARFLVECGKASSMADVFKKYLARGKTGYVPPQWCTI
EQAIDVIHHSGGKAVLAHPGRYNLSAKWLKRLVAHFAEHHGDAMEVAQCQQSPNERTQLA
ALARQHHLWASQGSDFHQPCPWIELGRKLWLPAGVEGVWQLWEQPQNTTEREL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgacacgaattatgcagtgatttacgacctgcacagccataccacagcttccgat
ggctgcctgacgccagaagcattggtgcaccgtgcagtcgagatgcgcgtcggcaccctg
gcgatcaccgaccatgacaccacagctgcaatcgcgccagcaagagaggaaatttcacgt
tcgggactggcgttgaatcttattcccggcgtggaaatttccacggtctgggaaaatcat
gaaattcatattgtcgggctgaatattgatattactcatccgctaatgtgtgagttcctc
gcgcagcagacagaacggcgcaatcagcgggcgcagctgattgccgaaagacttgaaaaa
gcgcaaatacctggggcgctggaaggcgcacaacgactggcgcagggcggcgcagtgacg
cgcggtcattttgcgcgtttccttgttgagtgcggcaaagccagttcaatggcggatgtc
tttaaaaagtatctggcgcgcgggaaaaccggatacgttccgccacagtggtgtacaata
gaacaagctattgatgtcattcatcattctggcggtaaggcggtgctagctcatcctggg
cggtacaatcttagtgctaaatggctgaaaagattggttgcgcattttgccgaacaccac
ggtgacgcgatggaagtcgcgcagtgccagcaatcgcccaatgaacgtacccagctggcg
gcccttgcgcgtcagcatcatttatgggcatcacaaggatctgattttcatcagccatgc
ccgtggatcgaactgggtcgtaaactctggctgcccgcaggcgttgaaggcgtctggcag
ctatgggaacagccgcagaacaccacagagagggaattatga

DBGET integrated database retrieval system