KEGG   Escherichia coli APEC O78: APECO78_12910Help
Entry
APECO78_12910     CDS       T02445                                 

Gene name
rrmA
Definition
(GenBank) 23S rRNA methyltransferase A
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
ecoa  Escherichia coli APEC O78
Brite
KEGG Orthology (KO) [BR:ecoa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ecoa03009]
    APECO78_12910 (rrmA)
Enzymes [BR:ecoa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     APECO78_12910 (rrmA)
Ribosome biogenesis [BR:ecoa03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    APECO78_12910 (rrmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_23 MTS Methyltransf_4 Ubie_methyltran Methyltransf_32 DUF938 MetW PrmA Methyltransf_29 Methyltransf_2 PCMT Pox_MCEL Methyltransf_8 Methyltransf_9 Rad50_zn_hook NodS
Motif
Other DBs
NCBI-ProteinID: AGC87311
Structure
PDB: 

Position
complement(2655174..2655983)
Genome map
AA seq 269 aa AA seqDB search
MSFSCPLCHQPLSREKNSYICPQRHQFDMAKEGYVNLLPVQHKRSRDPGDSAEMMQARRA
FLDAGHYQPLRDAIVAQLRERLDDKATAVLDIGCGEGYYTHAFADALPEITTFGLDVSKV
AIKAAAKRYPQVTFCVASSHRLPFSDTSMDAIIRIYAPCKAEELARVVKPGGWVITATPG
PRHLMELKGLIYNEVHLHAPHAEQLEGFTLQQSAELCYPMRLRGDEAVALLQMTPFAWRA
KPEVWQTLAAKEVFDCQTDFNIHLWQRSY
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtctttttcctgtccactttgccatcagcctctttcgcgtgaaaaaaacagctatatc
tgtccccagcgacatcagtttgatatggcgaaagaagggtatgtcaatctgctgcccgtt
cagcataaacggtctcgtgatccgggcgacagcgcggaaatgatgcaagcacgccgcgca
ttcttagatgccggacattatcagccgctgcgtgatgcaattgtcgcccaactgagggaa
cggcttgatgataaggccacggcggtgctggatattggctgtggtgaagggtattacaca
cacgcatttgccgatgcgttgcccgaaatcaccacgtttggtctggatgtttcgaaggta
gcgataaaagcggcggcgaaacgctatccgcaggtcactttttgtgtcgcttccagccac
cgtttgccgttttccgataccagtatggacgccataatacgtatttacgcgccgtgtaaa
gcagaagaattagcacgagtagtgaagcccggcggctgggtcattactgccacgccggga
ccgcgacatttgatggagctgaaggggctgatttacaatgaagtacatcttcatgcacct
catgcagaacaactggaaggttttacattacagcagagtgcggagttgtgttatccgatg
cgtcttcgcggtgatgaagccgtcgcattattgcagatgacgccgtttgcctggcgtgcg
aagccagaagtctggcaaacactggcagcaaaagaagtgttcgactgccagacggacttt
aatattcacctctggcagcgttcttattaa

DBGET integrated database retrieval system