KEGG   Escherichia coli APEC O78: APECO78_13880Help
Entry
APECO78_13880     CDS       T02445                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
ecoa  Escherichia coli APEC O78
Pathway
ecoa00030  Pentose phosphate pathway
ecoa00480  Glutathione metabolism
ecoa01100  Metabolic pathways
ecoa01110  Biosynthesis of secondary metabolites
ecoa01120  Microbial metabolism in diverse environments
ecoa01130  Biosynthesis of antibiotics
ecoa01200  Carbon metabolism
Module
ecoa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ecoa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:ecoa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    APECO78_13880
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    APECO78_13880
Enzymes [BR:ecoa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     APECO78_13880
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     APECO78_13880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 ApbA F420_oxidored Shikimate_DH 3HCDH_N 2-Hacid_dh_C NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: AGC87503
Structure
PDB: 

Position
complement(2851241..2852647)
Genome map
AA seq 468 aa AA seqDB search
MLKQQIGVVGMAVMGRNLALNIESRGYTVSIYNRSREKTEEVIAENPGKKLVPYYTVKEF
VESLETPRRILLMVKAGAGTDAAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSSEGF
NFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILTKIAAVAEDGEPCVTYIGADGAGH
YVKMVHNGIEYGDMQLIAEAYSLLKGGLNLTNEELAQTFTEWNNGELSSYLIDITKDIFT
KKDEDGNYLVDVILDEAANKGTGKWTSQSALDLGEPLSLITESVFARYISSLKEQRVAAS
KVLSGPQAQPAGDKGEFIEKVRRALYLGKIVSYAQGFSQLRAASEEYNWDLNYGEIAKIF
RAGCIIRAQFLQKITDAYAENPQIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPT
FAAAVAYYDSYRAAVLPANLIQAQRDYFGAHTYKRIDKEGVFHTEWLD
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagcaacagatcggcgtagtcggtatggccgtgatggggcgcaaccttgcgctc
aacatcgaaagccgtggttataccgtctctatttacaaccgttcccgtgaaaagacggaa
gaagtgattgccgaaaatccaggcaagaaactggttccttactatacggtgaaagagttt
gttgaatctctggaaacgcctcgtcgcatcctgttaatggtgaaagcaggtgcaggcacg
gatgctgctattgattccctcaagccgtacctcgataaaggtgacatcatcattgatggt
ggtaacaccttcttccaggacaccattcgtcgtaaccgtgagctttcttcagaaggcttt
aacttcatcggtaccggtgtttccggcggtgaagagggggcgctgaaagggccgtccatc
atgcctggtggccagaaagaagcctatgaactggttgcaccgatcctgaccaaaatcgcc
gcagtagctgaagacggggagccatgcgttacctatattggtgccgatggtgcaggtcac
tatgtgaagatggttcacaacggtattgaatacggcgatatgcagctgattgctgaagcc
tattctctgcttaaaggtggcctgaacctcaccaacgaagaactggcacagacctttacc
gagtggaataacggtgaactgagtagctacctgatcgacatcaccaaagacatcttcacc
aaaaaagatgaagacggtaactacctggttgatgtgatcctggatgaagcggctaacaaa
ggtaccggtaaatggaccagccagagcgcgctggatctcggcgaaccgctgtcgctgatt
accgagtctgtgtttgcacgttatatctcttctctgaaagagcagcgtgttgccgcatct
aaagttctctcaggcccgcaagcgcagccagctggcgacaaaggtgagttcattgaaaaa
gttcgtcgtgctctgtatctaggcaaaatcgtttcttacgctcagggtttctctcagctg
cgcgcagcgtctgaagagtacaactgggatctgaactacggcgaaatcgcgaagattttc
cgtgctggctgcatcatccgtgcgcagttcctgcagaaaatcaccgatgcatatgccgaa
aatccgcagatcgctaacctgctgctggccccgtacttcaagcaaattgccgatgactac
cagcaggcgctgcgcgatgtcgttgcttatgcagtacagaacggtatcccggttccgacc
ttcgccgctgcggttgcctattacgatagctaccgtgccgctgttctgcctgcgaacctg
atccaggcacagcgtgactatttcggtgcacatacttataagcgcattgataaagaaggt
gtgttccatactgaatggctggattaa

DBGET integrated database retrieval system