KEGG   Escherichia coli APEC O78: APECO78_14925Help
Entry
APECO78_14925     CDS       T02445                                 

Definition
(GenBank) hybrid sensory kinase in two-component regulatory system with RcsB and YojN
  KO
K07677  two-component system, NarL family, capsular synthesis sensor histidine kinase RcsC [EC:2.7.13.3]
Organism
ecoa  Escherichia coli APEC O78
Pathway
ecoa02020  Two-component system
ecoa02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:ecoa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    APECO78_14925
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    APECO78_14925
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecoa01001]
    APECO78_14925
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ecoa02022]
    APECO78_14925
Enzymes [BR:ecoa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     APECO78_14925
Protein kinases [BR:ecoa01001]
 Histidine kinases
  NarL family
   APECO78_14925
Two-component system [BR:ecoa02022]
 NarL family
  RcsC-RcsD-RcsB (capsule synthesis)
   APECO78_14925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RcsC HATPase_c Response_reg HisKA DUF2931
Motif
Other DBs
NCBI-ProteinID: AGC87710
Structure
PDB: 

Position
complement(3082903..3085752)
Genome map
AA seq 949 aa AA seqDB search
MKYLASFRTTLKASRYMFRALALVLWLLIAFSSVFYIVNALHQRESEIRQEFNLSSDQAQ
RFIQRTSDVMKELKYIAENRLSAENGVLSPRGRETQADVPAFEPLFADSDCSAMSNTWRG
SLESLAWFMRYWRDNFSAAYDLNRVFLIGSDNLCMANFGLRDMPVERDTALKALHERINK
YRNAPQDDSGSNLYWISEGPRPGVGYFYALTPVYLANRLQALLGVEQTIRMENFFLPGTL
PMGVTILDENGHTLISLTGPESKIKGDPRWMQERSWFGYTEGFRELVLKKNLPPSSLSIV
YSVPVDKVLERIRMLILNAILLNVLAGAALFTLARMYERRIFIPAESDALRLEEHEQFNR
KIVASAPVGICILRTADGVNILSNELAHTYLNMLTHEDRQRLTQIICGQQVNFVDVLTSN
NTNLQISFVHSRYRNENVAICVLVDVSSRVKMEESLQEMAQAAEQASQSKSMFLATVSHE
LRTPLYGIIGNLDLLQTKELPKGVDRLVTAMNNSSSLLLKIISDILDFSKIESEQLKIEP
REFSPREVMNHITANYLPLVVRKQLGLYCFIEPDVPVALNGDPMRLQQVISNLLSNAIKF
TDTGCIVLHVRADGDYLSIRVRDTGVGIPAKEVVRLFDPFFQVGTGVQRNFQGTGLGLAI
CEKLISMMDGDISVDSEPGMGSQFTVRIPLYGAQYPQKKGVEGLSGKRCWLAVRNASLCQ
FLETSLQRSGIVVTTYEGQEPTPEDVLITDEVVSKKWQGRAVVTFCRRHIGIPLEKAPGE
WVHSVAAPHELPALLARIYLIEMESDDPANALPSTDKAVSDNDDMMILVVDDHPINRRLL
ADQLGSLGYQCKTANDGVDALNVLSKNHIDIVLSDVNMPNMDGYRLTQRIRQLGLTLPVI
GVTANALAEEKQRCLESGMDSCLSKPVTLDVIKQTLTVYAERVRKSRES
NT seq 2850 nt NT seq  +upstreamnt  +downstreamnt
ttgaaataccttgcttcttttcgtacaaccctgaaagcctcgcgctacatgttcagagca
ttggcgttagtgctctggctgttgattgctttttcatccgttttttacatcgttaatgcg
ttacatcagcgagaatcggaaattcgtcaggaatttaatctgagttccgatcaggctcag
cgctttattcaacgcacctctgatgtgatgaaagagctgaagtacatcgccgaaaatcgc
ttatcggcagaaaacggtgtgctttccccgcgtggacgagaaacgcaggcggatgtgcct
gcgtttgaaccgctgtttgccgactccgattgttccgcaatgagtaacacctggcgaggt
tctctggagtcattggcgtggtttatgcgctactggcgcgataatttttctgcggcttac
gatctaaaccgggtatttttaatcggcagcgataacctctgcatggccaatttcggtctg
cgtgatatgccagtggaacgcgataccgcgttgaaagctttgcatgaacgcatcaataaa
tatcgaaatgcaccacaagatgatagcggcagtaacctctactggatcagcgaaggtccg
cgccctggcgtcgggtatttttacgcgttgacgccagtttatctggcgaaccggttgcag
gcgcttttgggtgtcgagcagaccatccggatggagaactttttcttaccgggtacgttg
ccgatgggggttaccattcttgatgaaaatggtcataccctgatttcgcttaccggacca
gaaagtaaaattaagggcgatcctcgctggatgcaggaacgctcctggtttggctatacg
gaagggttccgggagctggtgctgaagaaaaatctgccaccctcatcgctaagcatcgtg
tattcggtgccggttgataaggtgctggaacgcattcgcatgttgatccttaacgcaatt
ttgctgaatgtgcttgccggagctgcattgtttactctcgcacggatgtacgagcgacgt
attttcattccggcggaaagcgacgccctgcgactggaagaacatgagcagttcaatcgc
aagattgtcgcctccgcgccagtgggtatctgcattttgcgtaccgctgatggcgtcaat
attttaagtaacgaactggcgcatacctatctcaatatgcttacgcatgaggaccgccaa
cgactgacgcaaattatctgtgggcagcaggtcaattttgttgatgtcctgaccagcaac
aataccaatctgcaaatcagcttcgtccattcgcgctatcgtaatgaaaacgtggccatt
tgtgtgctggtggatgtttcttcgcgcgtgaagatggaagagtcgttgcaggagatggca
caagcagcggaacaggcgagccagtcaaaatcgatgttccttgccaccgtcagtcatgag
ctgcgaacgccgctgtatggcattatcggtaacctggatctgttgcaaaccaaagagtta
ccgaaaggcgtcgatcggctggtgacggcaatgaacaactcttccagcctgttgttgaaa
attatcagcgatattctcgatttctcgaagattgaatcggaacagttgaagatcgaaccg
cgtgagttttcaccgcgtgaagtgatgaaccacatcaccgccaactatttaccgctggtg
gtacgcaagcagctaggcttgtactgctttattgaaccggatgtgccagtggccttaaat
ggcgacccgatgcgtttacagcaggtcatctccaacctgttgagtaacgccataaaattc
accgataccggctgtatagttttgcatgtccgcgctgatggcgattatctctctatccgt
gttcgcgataccggcgtggggattccggcgaaagaagtggtgcgcttgtttgatcccttc
ttccaggtcggaacgggcgtacagcgaaacttccaggggaccggtctgggtctggcgatt
tgtgaaaaactgatcagcatgatggacggcgatatctcggtagattcagaaccgggaatg
ggcagccagtttaccgtgcgtattccgttgtacggcgctcagtacccgcagaaaaaaggc
gtggaagggttgagtggtaaacgctgctggctggcggtccgcaatgcgtcgctctgtcag
ttcctggaaaccagtttgcagcgcagcggcatcgtcgttacaacatacgaagggcaggaa
ccgactcccgaagatgtgttaattactgacgaggtagtgagtaaaaaatggcagggtaga
gcggtagtgaccttctgtcgtcgccatattggtattccgctggagaaagcgccaggggag
tgggtacacagtgtggctgccccgcatgagctaccggcattgttggcgcgtatttatttg
atcgagatggagagcgacgatcctgctaacgctctgccgtcgacggacaaagcggtcagc
gataatgacgatatgatgattctggtcgtggatgatcatccgattaaccgacgtctgctg
gcagatcagttgggatcgttgggctatcaatgtaaaaccgcgaatgatggtgtcgatgcg
cttaatgtacttagcaagaatcatattgatatcgtgcttagcgacgtcaacatgccaaat
atggatggttaccgcttgacgcaacgcattcgtcagttgggactgacgttgccggtaatc
ggagtaactgctaatgcgttggctgaagagaagcagcggtgtctggagtccggtatggac
agctgcctgtcgaagccggtaacgctggatgtgataaaacagacgctgacggtatatgcc
gagagggtcaggaaatcgcgggaatcgtag

DBGET integrated database retrieval system