KEGG   Escherichia coli APEC O78 (APEC): APECO78_15300Help
Entry
APECO78_15300     CDS       T02445                                 

Definition
(GenBank) acetate kinase A/propionate kinase 2
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
ecoa  Escherichia coli APEC O78 (APEC)
Pathway
ecoa00430  Taurine and hypotaurine metabolism
ecoa00620  Pyruvate metabolism
ecoa00640  Propanoate metabolism
ecoa00680  Methane metabolism
ecoa01100  Metabolic pathways
ecoa01120  Microbial metabolism in diverse environments
ecoa01200  Carbon metabolism
Module
ecoa_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:ecoa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    APECO78_15300
   00640 Propanoate metabolism
    APECO78_15300
  09102 Energy metabolism
   00680 Methane metabolism
    APECO78_15300
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    APECO78_15300
Enzymes [BR:ecoa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     APECO78_15300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AGC87783
Position
3174492..3175694
Genome map
AA seq 400 aa AA seqDB search
MSSKLVLVLNCGSSSLKFAIIDAVNGEEYLSGLAECFHLPEARIKWKMDGNKQEAALGAG
AAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVVIDESVIQGIKDAASFA
PLHNPAHLIGIEEALKSFPQLKDKNVAVFDTAFHQTMPEESYLYALPYNLYKEHGIRRYG
AHGTSHFYVTQEAAKMLNKPVEELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGLVM
GTRSGDIDPAIIFHLHDTLGMSVDAINKLLTKESGLLGLTEVTSDCRYVEDNYATKEDAK
RAMDVYCHRLAKYIGAYTALMDGRLDAVVFTGGIGENAAMVRELSLGKLGVLGFEVDHER
NLAARFGKSGFINKEGTRPAVVIPTNEELVIAQDASRLTA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtaagttagtactggttctgaactgcggtagttcttcactgaaatttgccatc
atcgatgcagtaaatggtgaagagtacctttctggtttagccgaatgtttccacctgccc
gaagcacgtatcaaatggaaaatggacggtaataaacaggaagcggctttaggtgcaggc
gccgctcacagcgaagcgctcaactttatcgttaatactattctggcacaaaaaccagaa
ctgtctgcgcagctgactgctatcggtcaccgtatcgtacacggcggcgaaaagtatacc
agctccgtagtgatcgatgagtctgttattcagggtatcaaagatgcagcttcttttgca
ccgctgcacaacccggctcacctgatcggtatcgaagaagctctgaaatctttcccacag
ctgaaagacaaaaacgttgctgtatttgacaccgcgttccaccagactatgccggaagag
tcttacctctacgccctgccttacaacctgtacaaagagcacggcatccgtcgttacggc
gcgcacggcaccagccacttctatgtaacccaggaagcggcaaaaatgctgaacaaaccg
gtagaagaactgaacatcatcacctgccacctgggcaacggtggttccgtttctgctatc
cgcaacggtaaatgcgttgacacctctatgggcctgaccccgctggaaggtctggtcatg
ggtacccgttctggtgatatcgatccggcgatcatcttccacctgcacgacaccctgggc
atgagcgttgacgcaatcaacaaactgctgaccaaagagtctggcctgctgggtctgacc
gaagtgaccagcgactgccgctatgttgaagacaactacgcgacgaaagaagacgcgaag
cgcgcaatggacgtttactgccaccgcctggcgaaatacatcggtgcctacactgcgctg
atggatggtcgtctggacgctgttgtattcactggtggtatcggtgaaaatgccgcgatg
gttcgtgaactgtctctgggcaaactgggcgtgctgggctttgaagttgatcatgaacgc
aacctggctgcacgtttcggcaaatctggtttcatcaacaaagaaggtacccgtcctgcg
gtggttatcccaaccaacgaagaactggttatcgcgcaagacgcgagccgcctgactgcc
tga

DBGET integrated database retrieval system