KEGG   Escherichia coli APEC O78 (APEC): APECO78_18055
Entry
APECO78_18055     CDS       T02445                                 

Definition
(GenBank) xanthine dehydrogenase iron-sulfur-binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ecoa  Escherichia coli APEC O78 (APEC)
Pathway
ecoa00230  Purine metabolism
ecoa01100  Metabolic pathways
ecoa01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecoa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    APECO78_18055
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AGC88330
Position
3747746..3748225
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
catgccgcaccaggtacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgctggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgcttgaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgcg
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacggttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system