KEGG   Emcibacter congregatus: FIV45_06320Help
Entry
FIV45_06320       CDS       T06024                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
ecog  Emcibacter congregatus
Brite
KEGG Orthology (KO) [BR:ecog00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    FIV45_06320 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: QDE29190
Position
1434567..1434977
Genome map
AA seq 136 aa AA seqDB search
MTIGTHAYEATTHGVRVSVQPFYLEEESDPEEGQFFWAYQVQIENLGDETVQLKSRYWRI
TDSLGRTEEVHGDGVVGEQPMIDPGYVFEYTSGAPLTTASGFMGGSYEMHKNDGSAFEVE
IPSFSLDSPYSSHTVN
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgacgattggcacacatgcttatgaggcaacgactcatggcgtgcgggtctctgttcag
cctttttatctcgaggaagaatctgatccggaagaagggcagtttttctgggcatatcag
gtacagatcgagaatctcggtgatgagacggtgcaactgaaaagccgttactggcgcatt
acggattccctgggcagaaccgaagaagtccatggtgacggggtcgtgggggaacaaccg
atgatcgatcccggatatgtctttgaatataccagcggtgcgccactgaccacagcctcc
ggctttatggggggatcttatgaaatgcataagaacgacggatctgcgttcgaagttgaa
atccccagtttctcgcttgatagcccttatagctcacatacagttaattaa

DBGET integrated database retrieval system