KEGG   Emcibacter congregatus: FIV45_10500Help
Entry
FIV45_10500       CDS       T06024                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
ecog  Emcibacter congregatus
Pathway
ecog00630  Glyoxylate and dicarboxylate metabolism
ecog01100  Metabolic pathways
ecog01110  Biosynthesis of secondary metabolites
ecog01120  Microbial metabolism in diverse environments
ecog01130  Biosynthesis of antibiotics
ecog01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ecog00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    FIV45_10500
Enzymes [BR:ecog01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     FIV45_10500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: QDE27677
Position
complement(2322082..2323233)
Genome map
AA seq 383 aa AA seqDB search
MIENVTLDISGERFQVFYRLRCEAQDVEAFARHICVEQTIEFPAELIGDDDIRRHVMGQV
VSLAPLDDHSWRVVISYAVEITGFSLTQTMNVIFGNVSLMPGVRVDRLEFPDSFLSRFKG
PRFGLQGLRDLVGEKHQQLYCSALKPMGLSADQLAQQAYQLALGEFHFIKDDHGLADQPF
APFRERVSRCVEQVAKANQQTGGSSRYVVSLNSPAEQIVEDAIWAKEQGVGGLLVPPGIV
GFDMMRRLADDDRIGLPILCHPSHLGSYVASPDNGLSFYALFGQLARLAGADVSIYPNFG
GRFSFTRDQCLEIVKGCTDPMAILKPIVASPGGGMNFSNVQDMVDAYGKDIMFLIGGALH
KGDATVPENCRAFKAQVAALLRR
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgattgagaatgtaacgcttgatatatccggggaacggttccaggtattttaccgtttg
cgctgcgaggcgcaggatgtggaggcgtttgcccgccacatttgtgtcgaacagaccatt
gaattcccggcggaactgatcggggatgacgatattcgccgtcacgtgatgggacaggtt
gtctctctggcgccgttggacgaccacagctggcgggtggtgatttcctatgccgttgaa
attaccgggtttagcctgacccagaccatgaatgtcatttttggtaatgtcagcctgatg
ccgggcgtgcgggtcgatcgtcttgaatttcctgacagttttctgtcccgtttcaaaggg
ccgcgttttggtcttcagggattgcgcgacctggttggcgaaaaacatcaacagctctat
tgttccgcgttgaaaccgatggggctgtccgcagaccaactggcgcagcaggcttatcaa
ctggcgttgggcgagtttcactttatcaaggatgatcatggtcttgctgatcagcctttt
gcgcctttccgtgagcgggtgtcccggtgtgtggaacaagtggcaaaagccaatcaacag
accggaggcagcagccgctacgtggtaagcctgaattctccggcggagcagattgtcgaa
gatgcgatctgggcgaaagagcagggcgttggcggtctgctggtcccgccaggcatcgtc
ggatttgacatgatgcgtcgtctggcggatgatgaccggatcggcctgcccatcctgtgt
catccatcccatctgggcagttatgtcgccagccccgataatggcctttccttttacgcg
ctgtttggacaactggcgcgtctggccggggcggatgtcagtatttatcccaattttggc
ggacgtttttccttcacccgcgatcagtgtctggaaattgtcaagggctgcactgatccc
atggccatcctgaagccgatcgttgcgtctcccggagggggcatgaacttttcaaatgtt
caggacatggtcgacgcctacgggaaagatataatgttcctcattggcggggcgttgcat
aaaggggatgcgacggttcctgaaaattgccgtgcgttcaaagcccaggtcgccgccttg
ttgcgtagataa

DBGET integrated database retrieval system