KEGG   Emcibacter congregatus: FIV45_17800Help
Entry
FIV45_17800       CDS       T06024                                 

Definition
(GenBank) carbon-nitrogen hydrolase family protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
ecog  Emcibacter congregatus
Brite
KEGG Orthology (KO) [BR:ecog00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FIV45_17800
Enzymes [BR:ecog01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     FIV45_17800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase Homeodomain
Motif
Other DBs
NCBI-ProteinID: QDE29342
Position
complement(4070124..4070927)
Genome map
AA seq 267 aa AA seqDB search
MSSGNQRADNMVVADNLIREAVARGADLVMTPEMTTLIGLDRTALMEQIFTEASDPSLKQ
FQRLARDLGIWLMIGSMAVRVGDKIANRCYMIDPTGLIVNRYDKIHMFDVDLPNGESYRE
SRSYEAGAWAVISETPWGKLGHSICYDVRFPGLYRTLAQAGAQMLTVPAAFTRVTGEAHW
HILLRARAIENGVFVFAPAQTGTHENAKGVRRETYGHSLIVDPWGNILDDGGTDVGVTVA
EIDLALCDQARERIPSLAHDREFKVRL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccggtaaccagagggcggataatatggtcgtggcggacaacttgatccgcgag
gcggtcgcccggggggcggatctggtgatgacgccggaaatgacgactcttataggactg
gatcgtacggcgctgatggagcagattttcaccgaagcctctgatccgagcctgaaacag
tttcagaggctggcgcgggatctgggtatctggttgatgatcggttcgatggccgtgcgg
gttggggataaaatcgccaaccggtgctatatgattgaccccacgggattgatagtgaac
cgctatgataaaattcacatgtttgatgtggatttgccgaatggcgagagctatcgcgaa
tcccggtcttatgaagcgggcgcctgggcggtgatcagtgaaactccctggggaaagctt
ggccatagcatttgttatgatgtacgctttccggggctttatcgcaccctggcccaggcc
ggggcgcagatgttgacggttccggcggccttcacccgggtgaccggagaagcccattgg
catatattgctcagggcacgggcgattgagaatggtgtttttgtctttgcgccggcgcaa
accgggactcatgaaaacgccaagggcgttcgacgggaaacttatggccattcactaatt
gttgacccctggggcaatatactagatgatggagggacggatgttggcgtcacggtggct
gaaattgatcttgcgttatgtgatcaggcccgggaacgcattccctcactggcccatgac
cgcgaattcaaggtgaggctttaa

DBGET integrated database retrieval system