KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_0332Help
Entry
ECRM13516_0332    CDS       T03011                                 

Gene name
mhpE
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh00360  Phenylalanine metabolism
ecoh00362  Benzoate degradation
ecoh00621  Dioxin degradation
ecoh00622  Xylene degradation
ecoh01100  Metabolic pathways
ecoh01120  Microbial metabolism in diverse environments
ecoh01220  Degradation of aromatic compounds
Module
ecoh_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    ECRM13516_0332 (mhpE)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECRM13516_0332 (mhpE)
   00622 Xylene degradation
    ECRM13516_0332 (mhpE)
   00621 Dioxin degradation
    ECRM13516_0332 (mhpE)
Enzymes [BR:ecoh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     ECRM13516_0332 (mhpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: AHG13020
Position
356269..357282
Genome map
AA seq 337 aa AA seqDB search
MNGKKLYISDVTLRDGMHAIRHQYSLENVRQIAKALDDARVDSIEVAHGDGLQGSSFNYG
FGAHSDLEWIEAAADVVKHAKIATLLLPGIGTIHDLKNAWQAGARVVRVATHCTEADVSA
QHIQYARELGMDTVGFLMMSHMTTPENLAKQAKLMEGYGATCIYVVDSGGAMNMSDIRDR
FRALKAVLKPETQTGMHAHHNLSLGVANSIAAVEEGCDRIDASLAGMGAGAGNAPLEVFI
AAADKLGWQHGADLYALMDAADDLVRPLQDRPVRVDRETLALGYAGVYSSFLRHCETAAA
RYGLSAVDILVELGKRRMVGGQEDMIVDVALDLRNNK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtaaaaaactttatatctcggacgtcacgttgcgtgacggtatgcacgccatt
cgtcatcagtattcgctggaaaacgttcgccagattgccaaagcactggacgatgcccgc
gtggattcgattgaagtggcccacggcgacggtttgcagggttccagctttaactatggt
ttcggcgcacatagcgaccttgaatggattgaagcggcggcggatgttgtgaagcacgcc
aaaatcgcgacgttgttgctgccaggaatcggcactattcacgatctgaaaaatgcctgg
caggctggcgcgcgggtggttcgtgtggcaacgcactgtaccgaagctgatgtttccgcc
cagcatattcagtatgcccgcgagctcggaatggacaccgttggttttctgatgatgagc
catatgaccacgccggagaatctcgccaagcaggcaaagctgatggaaggctacggtgcg
acctgtatttatgtggtggattctggcggtgcgatgaacatgagcgatatccgtgaccgt
ttccgcgccctgaaagcagtgctgaaaccagaaacgcaaaccggcatgcacgctcaccat
aacctgagtcttggcgtggcgaactctatcgcggcggtggaagagggctgcgaccgaatc
gacgccagcctcgcgggaatgggcgcgggcgcaggtaacgcgccgctggaagtatttatt
gccgccgcggataaactgggttggcagcatggggccgatctctatgcgttaatggatgcc
gctgacgacctggtgcgtccgttgcaggatcgaccggtacgagtcgatcgcgaaacgctg
gcgctgggatacgctggtgtttactccagcttcctgcgtcactgtgaaacggcggcggcg
cgttatggcttaagcgcggtggatattctcgttgagctgggcaaacgccggatggttggc
ggccaggaggatatgatcgtcgacgtggcgctggatctgcgcaacaacaaataa

DBGET integrated database retrieval system