KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_1891Help
Entry
ECRM13516_1891    CDS       T03011                                 

Gene name
yneI
Definition
(GenBank) Succinate-semialdehyde dehydrogenase [NAD]; Succinate-semialdehyde dehydrogenase [NADP+]
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh00250  Alanine, aspartate and glutamate metabolism
ecoh00650  Butanoate metabolism
ecoh00760  Nicotinate and nicotinamide metabolism
ecoh01100  Metabolic pathways
ecoh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ECRM13516_1891 (yneI)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECRM13516_1891 (yneI)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ECRM13516_1891 (yneI)
Enzymes [BR:ecoh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     ECRM13516_1891 (yneI)
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     ECRM13516_1891 (yneI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh baeRF_family2
Motif
Other DBs
NCBI-ProteinID: AHG14559
Position
complement(1896353..1897741)
Genome map
AA seq 462 aa AA seqDB search
MTITPATHAISINPATGEQLSVLPWAGADDIENALQLAAAGFRDWRETNIDYRAEKLRDI
GKALRARSEEMAQMITREMGKPINQARAEVAKSANLCDWYAEHGPAMLKAEPTLVENQQA
VIEYRPLGTILAIMPWNFPLWQVMRGAVPIILAGNGYLLKHAPNVMGCAQLIAQVFKDAG
IPQGVYGWLNADNDGVTQMIKDSRIAAITVTGSVRAGAAIGAQAGAALKKCVLELGGSDP
FIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIIEEGIASAFTERFVAAAAALKMGDP
RDEENTLGPMARFDLRDELHHQVEKTLAQGARLLLGGEKMAGAGNYYPPTVLANVTPEMT
AFREEMFGPVAAITVAKDAEHALELANDSEFGLSATIFTTDETQARQMAARLECGGVFIN
GYCASDARVAFGGVKKSGFGRELSHFGLHEFCNIQTVWKDRI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaccattactccggcaactcatgcaatttcgataaatcctgccacgggtgaacaactt
tctgtgctgccgtgggctggcgctgatgatatcgaaaacgcacttcagctggcggcagca
ggctttcgtgactggcgcgagacaaatatagattatcgtgctgaaaaactgcgtgatatc
ggtaaggctctgcgcgcccgtagcgaagaaatggcgcaaatgatcacccgcgaaatgggc
aaaccaatcaaccaggcgcgcgctgaagtggcgaaatcggcgaatttgtgtgactggtat
gcagaacatggtccggcaatgctgaaggcggaacctacgctggtggaaaatcagcaggca
gttattgagtatcgaccgttggggacgattctggcgattatgccgtggaattttccgtta
tggcaggtgatgcgtggcgctgttcccatcattcttgcaggtaacggctacttacttaaa
catgcgccgaatgtgatgggctgtgctcagctcattgcccaggtgtttaaagatgcggga
atcccacaaggcgtatatggctggctgaatgccgacaatgacggtgtcactcagatgatt
aaagactcgcgcattgctgctatcacggtgaccggaagtgttcgtgctggagcggctatt
ggcgcacaggctggagcggcactgaaaaaatgcgtactggaactgggcggttcggatccg
tttattgtgcttaacgatgccgatctggaactggcggtgaaagcggcggtagccggacgt
tatcagaataccggacaggtttgtgcagcggcaaaacgttttatcatcgaagagggaatt
gcttcggcatttaccgaacgttttgtggcagctgcggcagccttgaaaatgggcgatccc
cgtgacgaagagaacactctcggaccaatggctcgttttgatttacgtgatgagctgcat
catcaggtggagaaaaccctggcgcagggtgcgcgtttgctactgggcggggaaaagatg
gctggggcaggtaactactatccgccaacggttctggcgaatgttaccccagaaatgacc
gcgtttcgggaagaaatgtttggccccgttgcggcaatcaccgttgcgaaagatgcagaa
catgcgctggaactggctaatgatagtgagttcggcctttcagcgaccatttttaccact
gacgaaacacaggccagacagatggcggcacgtctggaatgcggtggggtgtttatcaat
ggttattgtgccagcgatgcgcgagtggcctttggtggcgtgaaaaagagtggctttggt
cgtgagctttcccatttcggcttacacgaattctgtaatatccagacggtgtggaaagac
cggatctga

DBGET integrated database retrieval system