KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_3739Help
Entry
ECRM13516_3739    CDS       T03011                                 

Gene name
glcB
Definition
(GenBank) Malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh00620  Pyruvate metabolism
ecoh00630  Glyoxylate and dicarboxylate metabolism
ecoh01100  Metabolic pathways
ecoh01110  Biosynthesis of secondary metabolites
ecoh01120  Microbial metabolism in diverse environments
ecoh01200  Carbon metabolism
Module
ecoh_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECRM13516_3739 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    ECRM13516_3739 (glcB)
Enzymes [BR:ecoh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     ECRM13516_3739 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase DUF3937
Motif
Other DBs
NCBI-ProteinID: AHG16368
Structure
PDB: 

Position
complement(3700049..3702220)
Genome map
AA seq 723 aa AA seqDB search
MSQTITQGRLRIDANFKRFVDEEVLPGTGLDAAAFWRNFDEIVYDLAPENRQLLAERDRI
QAALDEWHRSNPGPVKDKAAYKSFLRELGYLVPQPERVTVETTGIDSEITSQAGPQLVVP
AMNARYALNAANARWGSLYDALYGSDIIPQEGAMVSGYDPQRGEQVIAWVRRFLDESLPL
ENGSYQDVVAFKVVDKQLRIQLKNGKETTLRTPAQFVGYRGDAAAPTCILLKNNGLHIEL
QIDANGRIGKDDPAHINDVIVEAAISTILDCEDSVAAVDAEDKILLYRNLLGLMQGTLQE
KMEKNGRQIVRKLNDDRHYTAADGSEISLHGRSLLFIRNVGHLMTIPVIWDSEGNEIPEG
ILDGVMTGAIALYDLKVQKNSRTGSVYIVKPKMHGPQEVAFANKLFTRIETMLGMAPNTL
KMGIMDEERRTSLNLRSCIAQARNRVAFINTGFLDRTGDEMHSVMEAGPMLRKNQMKSTP
WIKAYERNNVLSGLFCGLRGKAQIGKGMWAMPDLMADMYSQKGDQLRAGANTAWVPSPTA
ATLHALHYHQTNVQSVQANIAQTEFNAEFEPLLDDLLTIPVAENANWSAQEIQQELDNNV
QGILGYVVRWVEQGIGCSKVPDIHNVALMEDRATLRISSQHIANWLRHGILTKEQVQASL
ENMAKVVDQQNAGDPAYRPMAGNFANSCAFKAASDLIFLGVKQPNGYTEPLLHAWRLREK
ESH
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaaccataacccagggccgtttacgcattgacgccaattttaaacgttttgtg
gatgaagaagttttaccgggaacagggctggacgctgcggcgttctggcgcaattttgat
gagatcgtttacgatctggcaccagaaaatcgtcagttgctggcagaacgcgatcgcatt
caggcggcgcttgatgagtggcatcgcagcaatccggggccggtaaaagataaagcggcc
tataaatctttcctgcgtgaactgggctacctggtaccgcaaccggagcgcgtgacggtg
gaaaccacgggcattgacagcgaaatcaccagtcaggcggggccacagctggtggttccg
gcaatgaacgcccgctacgcgctgaacgcggcgaacgctcgctggggctcactgtacgat
gcgttatacggcagcgacatcatcccgcaggaaggggcgatggtcagcggctacgatccg
caacgcggtgagcaggttatcgcctgggttcggcgtttcctcgatgaatctctaccgctg
gaaaacggcagctatcaggatgtggtggcgtttaaggtggtcgataaacaattacgcatc
cagttgaaaaatggtaaagaaaccacgttacgtaccccggcgcagtttgtcggttaccgt
ggcgatgccgctgcgccgacctgcattttgctgaaaaataacggcctgcatattgaactg
caaatcgatgccaacgggcggattggcaaagacgatccggcgcacatcaacgatgttatc
gtcgaagcggccatcagtaccattctcgactgcgaagattcggtcgcggcggttgatgcg
gaagataaaatcctgctgtaccgcaacctgctgggcctgatgcaggggactctgcaagag
aaaatggagaaaaacggtcgacaaatcgtgcgtaaactgaatgacgatcgtcattacacc
gccgccgatggctctgaaatttctctgcacggacgctcgctgctgtttatccgcaacgtg
ggtcatttgatgaccattcctgtgatttgggacagcgaaggcaatgaaatcccggaaggc
attcttgatggcgtcatgactggcgcgattgccctctatgatttaaaagtgcagaaaaac
tcgcgcactggcagcgtctatattgtgaaaccgaaaatgcacggtccgcaggaagtggcg
ttcgccaacaaactgtttacccgcattgagacaatgctcggtatggcaccgaataccctg
aaaatgggcattatggatgaagaacgccggacctcgctgaacttgcgtagctgtatcgct
caggcgcgcaaccgcgtggcgttcatcaatacaggtttcctcgaccgtaccggcgatgaa
atgcattcggtgatggaagctggcccgatgctgcgtaaaaaccagatgaaatcgacgccg
tggatcaaagcctacgaacgtaataacgtgctttccggcctgttctgtgggctgcgcggt
aaagcgcaaatcggtaaaggcatgtgggcaatgccggacctgatggcagacatgtacagc
cagaagggcgaccaactgcgtgccggggcaaacacagcctgggttccgtcgccaactgcc
gctacgctccatgcgctgcactaccaccaaaccaacgtacagagcgtgcaagccaacatt
gcccagaccgagttcaatgctgaatttgaaccgctgctggacgatctgctgactattccg
gttgctgaaaacgctaactggtcggcgcaagagatccaacaagagctggataacaacgtg
caggggattctggggtacgtggtgcgctgggtggagcaggggattggttgttcaaaagtg
ccggatattcacaatgtggcgctgatggaagaccgcgcaacgctgcgtatctccagccag
catatcgccaactggttacgtcacggtattctgaccaaagaacaggtgcaggcgtcgctg
gagaatatggcgaaagtggttgatcagcaaaacgctggcgatccggcttatcgtccgatg
gcggggaatttcgctaactcgtgtgcctttaaggctgccagcgatttaatcttccttggt
gtgaaacagccaaacggctataccgaaccgttattacacgcctggcgtttgcgcgaaaaa
gaaagtcattaa

DBGET integrated database retrieval system