KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_4719Help
Entry
ECRM13516_4719    CDS       T03011                                 

Gene name
hemN
Definition
(GenBank) Coproporphyrinogen III oxidase, oxygen-independent
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh00860  Porphyrin and chlorophyll metabolism
ecoh01100  Metabolic pathways
ecoh01110  Biosynthesis of secondary metabolites
Module
ecoh_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ECRM13516_4719 (hemN)
Enzymes [BR:ecoh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     ECRM13516_4719 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AHG17318
Structure
PDB: 

Position
4677083..4678456
Genome map
AA seq 457 aa AA seqDB search
MSVQQIDWDLALIQKYNYSGPRYTSYPTALEFSEDFGEQAFLQAVARYPERPLSLYVHIP
FCHKLCYFCGCNKIVTRQQHKADQYLDALEQEIVHRAPLFAGRHVSQLHWGGGTPTYLNK
AQISRLMKLLRENFQFNADAEISIEVDPREIELDVLDHLRAEGFNRLSMGVQDFNKEVQR
LVNREQDEEFIFALLNHAREIGFTSTNIDLIYGLPKQTPESFAFTLKRVAELNPDRLSVF
NYAHLPTIFAAQRKIKDADLPSPQQKLDILQETIAFLTQSGYQFIGMDHFARPDDELAVA
QREGVLHRNFQGYTTQGDTDLLGMGVSAISMIGDCYAQNQKELKQYYQQVDEQGNALWRG
IALTRDDCIRRDVIKSLICNFRLDYAPIEKQWDLHFADYFAEDLKLLAPLAKDGLVDVDE
KGIQVTAKGRLLIRNICMCFDTYLRQKARMQQFSRVI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtacagcaaatcgactgggatctggccctgatccagaaatataactattccggg
ccacgatacacctcgtacccgaccgcgctggagttttcagaagacttcggcgaacaggcg
tttttacaagccgtggcgcgctatcctgagcgtccattatctctctacgtacatatcccg
ttctgccataagctttgttacttctgcggttgcaataagattgttactcgccagcagcac
aaggccgatcagtatctggacgcgctggagcaagaaatcgtccatcgtgcaccgctgttc
gccgggcgtcacgtcagccagctgcactggggcggcggaacgccgacgtatcttaataaa
gcgcaaatcagccgcctgatgaagctgctgcgcgaaaacttccagttcaatgccgatgcg
gagatttcgatcgaagtcgatccgcgggaaatcgaactggatgtactcgatcatttacgc
gccgagggctttaatcgcctgagtatgggcgtgcaggacttcaacaaagaagtgcaacgt
ctggttaaccgcgagcaggatgaagagtttatctttgcgctgcttaaccatgcgcgtgag
attggctttacctccaccaacatcgacctgatttacggcctgccgaaacagacgccggaa
agtttcgcctttaccctgaaacgcgtggcggagctaaaccctgaccgtctgagcgtcttt
aactacgcgcatttgccgaccatttttgctgctcagcgcaaaatcaaagatgctgacctg
ccgagtccgcagcaaaaactcgatatcctgcaggaaaccatcgccttcctgacgcaatcg
ggctatcagtttatcggtatggatcactttgcccgtccggatgacgagctggcggtggcc
cagcgtgaaggcgtgctgcatcgtaatttccagggctacaccactcagggcgataccgat
ctgctggggatgggcgtttccgccatcagcatgattggcgactgctacgcgcagaaccag
aaagagttgaaacagtactatcagcaagtggatgaacaaggcaatgcgctgtggcgtggt
attgcgctaacgcgtgatgactgtattcgccgcgatgtgattaagtcgctcatctgcaac
ttccgtctggattacgcccctattgagaaacagtgggatttgcacttcgctgattacttt
gcggaagatctcaagctgctcgccccgttagcaaaagatgggctggtggatgtggatgag
aagggaatacaggtgacggcgaaaggtcgcttgctgatccgcaacatttgcatgtgcttt
gatacctatctgcgccagaaagcgcggatgcagcagttctctcgggtgatttaa

DBGET integrated database retrieval system