KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_4792Help
Entry
ECRM13516_4792    CDS       T03011                                 

Gene name
metB
Definition
(GenBank) Cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh00270  Cysteine and methionine metabolism
ecoh00450  Selenocompound metabolism
ecoh00920  Sulfur metabolism
ecoh01100  Metabolic pathways
ecoh01110  Biosynthesis of secondary metabolites
ecoh01130  Biosynthesis of antibiotics
ecoh01230  Biosynthesis of amino acids
Module
ecoh_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ECRM13516_4792 (metB)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ECRM13516_4792 (metB)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ECRM13516_4792 (metB)
Enzymes [BR:ecoh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     ECRM13516_4792 (metB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AHG17391
Structure
PDB: 

Position
4747067..4748227
Genome map
AA seq 386 aa AA seqDB search
MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRA
LAELEGGAGAVLTNTGMSAIHLVTTVFLKPGDLLVAPHDCYGGSYRLFDSQAKRGCYRVL
FVDQGDEQALRAALAEKPKLVLIESPSNPLLRVVDIAKICHLAREVGAVSVVDNTFLSPA
LQNPLALGADLVLHSCTKYLNGHSDVVAGVVIAKDPDVVTELAWWANNIGVTGGAFDSYL
LLRGLRTLVPRMELAQRNAQAIVKYLQTQPLVKKLYHPSLPENQGHEIAARQQKGFGAML
SFELDGDEQTLRRFLGGLSLFTLAESLGGVESLISHAATMTHAGMAPEARAAAGISETLL
RISTGIEDGEDLIADLENGFRAANKG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtaaacaggccaccatcgcagtgcgtagcgggttaaatgacgacgaacagtat
ggttgcgttgtccctcccatccatctttccagcacctataactttaccggatttaatgaa
ccgcgcgcgcatgattactcgcgtcgcggcaacccaacgcgcgatgtggttcagcgtgcg
ctggcagaactggaaggcggtgctggtgcagtacttactaataccggcatgtccgcgatt
cacctggtaacgaccgtctttttgaaacctggcgatctgctggttgcgccgcacgactgc
tacggcggtagctatcgcctgttcgacagccaggcgaaacgcggttgctatcgcgtgttg
tttgttgatcaaggcgatgaacaggcattacgggcagcgctggcagaaaaacccaaactg
gtactgatagaaagcccaagtaatccattgttacgcgtcgtggatattgcgaaaatctgc
catctggcaagggaagtcggggcggtgagcgtggtggataacaccttcttaagcccggca
ttacaaaatccgctggcattgggtgccgatctggtgttgcattcatgtacgaaatatctg
aacggtcactctgacgtggtggctggcgtggtgattgctaaagacccggacgttgtcact
gaacttgcctggtgggcaaacaatattggcgtgacgggcggcgcgtttgacagctatctg
ctgctgcgcgggttgcgaacgctggtgccgcgtatggagctggcccagcgtaacgcgcag
gcgattgtgaaatatctgcaaacccagccgttggtgaaaaaactgtatcacccgtcgctg
ccggaaaatcaggggcatgaaattgccgcgcgtcagcaaaaaggctttggcgcaatgttg
agttttgaactggatggcgatgagcagacgctgcgtcgtttcctgggcgggctgtcgttg
tttacgctggcggaatcgttagggggagtggaaagtttaatctctcacgccgcaaccatg
acacatgcaggcatggcaccagaagcgcgtgctgccgccgggatctccgagacgctgctg
cgtatctccaccggtattgaagatggcgaagatttaattgccgacctggaaaatggcttc
cgggctgcaaacaaggggtaa

DBGET integrated database retrieval system