KEGG   Escherichia coli O145 H28 RM13516 (EHEC): ECRM13516_4823Help
Entry
ECRM13516_4823    CDS       T03011                                 

Gene name
murI
Definition
(GenBank) Glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
ecoh  Escherichia coli O145:H28 RM13516 (EHEC)
Pathway
ecoh00471  D-Glutamine and D-glutamate metabolism
ecoh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecoh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ECRM13516_4823 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ecoh01011]
    ECRM13516_4823 (murI)
Enzymes [BR:ecoh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     ECRM13516_4823 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:ecoh01011]
 Precursor biosynthesis
  Racemase
   ECRM13516_4823 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race DUF1847
Motif
Other DBs
NCBI-ProteinID: AHG17422
Structure
PDB: 

Position
4786523..4787311
Genome map
AA seq 262 aa AA seqDB search
MLVFDSGVGGLSVYDEIRHLLPDLHYIYAFDNVAFPYGEKSEAFIVERVVAIVTAVQERY
PLALAVVACNTASTVSLPALREKFDFPVVGVVPAIKPAARLTANGIVGLLATRGTVKRSY
THELIARFANECQIEMLGSAEMVELAEAKLHGEDVSLDALKRILRPWLRMKEPPDTVVLG
CTHFPLLQEELLQVLPEGTRLVDSGAAIARRTAWLLEHEAPDAKSADANIAFCMAMTPEA
EQLLPVLQRYGFETLEKLAVLG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtgtttgactccggcgtcggtgggttgtcggtctatgacgagatccggcatctc
ttaccggatctccattacatttatgctttcgataacgtcgctttcccgtatggcgaaaaa
agcgaagcgtttattgttgagcgagtggtggcaattgtcaccgcggtgcaagaacgttat
ccccttgcgctggctgtggtcgcttgcaacaccgccagtaccgtttcacttcctgcatta
cgcgaaaagttcgacttcccggttgttggtgtcgtgccggcgattaaacctgctgcacgt
ctgacggcaaatggcattgtcggattactggcaacccgcggaacagttaaacgttcttat
actcatgagctgatcgcgcgtttcgctaatgaatgccagatagaaatgctgggctcggca
gagatggttgagttggctgaagcgaagctgcatggcgaagatgtttctctggatgcacta
aaacgtatcctacgcccgtggttaagaatgaaagagccgccagataccgttgtattgggt
tgcacccatttccctctactacaagaagaactgttacaagtgctgccagagggaacccgg
ctggtggattctggcgcagcgattgctcgccgaacggcctggttgttagaacatgaagcc
ccggatgcaaaatctgccgatgcgaatattgccttttgtatggcaatgacgccagaagct
gaacaattattgcccgttttacagcgttacggcttcgaaacgctcgaaaaactggcagtt
ttaggctga

DBGET integrated database retrieval system