KEGG   Escherichia coli PMV-1: ECOPMV1_01563Help
Entry
ECOPMV1_01563     CDS       T02847                                 

Gene name
aldA
Definition
(GenBank) Lactaldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
ecoi  Escherichia coli PMV-1
Pathway
ecoi00620  Pyruvate metabolism
ecoi00630  Glyoxylate and dicarboxylate metabolism
ecoi01100  Metabolic pathways
ecoi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecoi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECOPMV1_01563 (aldA)
   00630 Glyoxylate and dicarboxylate metabolism
    ECOPMV1_01563 (aldA)
Enzymes [BR:ecoi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     ECOPMV1_01563 (aldA)
    1.2.1.22  lactaldehyde dehydrogenase
     ECOPMV1_01563 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 LuxC
Motif
Other DBs
NCBI-ProteinID: CDH65010
Structure
PDB: 

Position
1573740..1575179
Genome map
AA seq 479 aa AA seqDB search
MSVPVQHPMYIDGQFVTWRGDAWIDVVNPATEVVISRIPDGQAEDARKAIDAAERAQPEW
EALPAIERASWLRKISAGIRERASEISALIVEEGGKIQQLAEVEVAFTADYIDYMAEWAR
RYEGEIIQSDRPGENILLFKRALGVTTGILPWNFPFFLIARKMAPALLTGNTIVIKPSEF
TPNNAIAFAKIVDEIGLPRGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVSAGEKIMAT
AAKNITKVCLELGGKAPAIVMDDADLELAVKAIVDSRVINSGQVCNCAERVYVQKSIYDQ
FVNRLGEAMQAVQFGNPAERNDIAMGPLINAAALERVEQKVARAVEEGARVALGGKAVEG
KGYYYPPTLLLDVRQEMSIMHEETFGPVLPVVAFDTLEEAISMANDSDYGLTSSIYTQNL
NVAMKAIKGLKFGETYINRENFEAMQGFHAGWRKSGIGGADGKHGLHEYLQTQVVYLQS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtacccgttcaacatcctatgtatatcgatggacagtttgttacctggcgtgga
gacgcatggattgatgtggtaaaccctgctacagaggttgtcatttcccgcattcccgat
ggtcaggccgaggatgcccgtaaggcaatcgatgcagcagaacgtgcacaaccagaatgg
gaagcgttgcctgctattgaacgcgccagttggttgcgcaaaatctccgccgggatccgg
gaacgtgccagtgaaatcagtgcgctgattgtcgaagaagggggcaagatccagcagttg
gctgaagtcgaagtggcttttactgcggactatatcgattatatggcggagtgggcacgg
cgttacgagggcgagattattcaaagcgatcgtccaggagaaaatatccttctgtttaaa
cgtgcgcttggcgtgactaccggcattctgccgtggaactttccgttcttcctcattgcc
cgcaaaatggctcccgctcttttgaccggtaataccatcgtcattaaacccagtgaattt
acgccaaacaatgcgattgcattcgccaaaatcgttgatgaaataggccttccgcgcggc
gtgtttaaccttgtactcgggcgtggtgaaaccgttgggcaagaactggcgggtaaccca
aaggtcgcaatggtcagtatgacaggcagcgtctctgcaggtgaaaagattatggcgact
gcggcgaaaaacatcaccaaagtgtgcctggaattggggggtaaagcaccggctatcgta
atggacgatgccgatcttgaactggcagtcaaagccatcgttgattcacgcgtcattaat
agtgggcaagtgtgtaactgtgcagaacgtgtttatgtacagaaaagcatttatgatcag
ttcgtcaatcggctgggggaagcgatgcaggcggttcaatttggtaaccccgctgaacgc
aacgacattgcgatgggaccgttgattaacgccgcggcgctggaaagggttgagcaaaaa
gtggcgcgcgcagtagaagaaggggcgagagtggcgttgggtggcaaagcggtagagggg
aaaggatattattatccgccgacattgctgctggatgttcgccaggaaatgtcgattatg
catgaggaaacctttggcccggttctgccggtggtcgcatttgacacgctggaagaggct
atctcaatggctaatgacagtgattacggcctgacctcatcaatctatacccaaaatctg
aacgtcgcgatgaaagccattaaagggctgaagtttggtgaaacttacatcaaccgtgaa
aacttcgaagctatgcaaggcttccacgctggatggcgtaaatccggtattggcggcgca
gatggtaaacatggcttgcatgaatatctgcagacccaggtggtttatttacagtcgtaa

DBGET integrated database retrieval system