KEGG   Escherichia coli PMV-1: ECOPMV1_03079
Entry
ECOPMV1_03079     CDS       T02847                                 

Gene name
yiaD_1
Definition
(GenBank) Inner membrane lipoprotein YiaD precursor
Organism
ecoi  Escherichia coli PMV-1
SSDB
Motif
Pfam: OmpA
Other DBs
NCBI-ProteinID: CDH66446
Position
3149013..3150665
AA seq 550 aa
MRNTLKQAIVLWGMVLLLVLWSVFISPSGVLRWAGAAAIVLAVAALLIYRRRQAWTEMTG
DAGLSSLPPETYRQPVVLVCGGLSAHLFTDSPVRQVSEGLYLHVPDEEQLVAQVERLLTL
RPAWASQLAVAYTIMPGIHRDVAVLAGRLRRFAHSMATVRRRAGVNVPWLLWSGLSGSPL
PERASSPWFICTGGEVQVATSTENAMPAQWIAQSGVQERSQRLSYLLKAESLMQWLDLNV
LAELNGPEAKCPPLAMAVGLVPSLPAVDNNLWQLWITARTGLTPDIADTGTDDALPFPDA
LLRRLPRQSGFTPLRRACVTMLGVTTVAGIAALCLSATANRQLLRQVGDDLHRFYAVPVE
EFITKARHLSVLKDDATMLDGYYREGEPLRLGLGLYPGERIRQPVLRAIRDWRPPEQKME
VTASLQVQTVRLDSMSLFDVGQARLKDGSTKVLVDALVNIRAKPGWLILVAGYTDATGDE
KSNQQLSLRRAEAVRNWMLQTSDIPATCFAVQGLGESQPAATNDTPQGRAVNRRVEISLV
PRSDACQDVK
NT seq 1653 nt   +upstreamnt  +downstreamnt
gtgaggaacacgctgaaacaggccatcgtgctgtggggaatggtgttactgctggtgctg
tggtcagtgtttatcagtccgtctggcgtgctgagatgggccggtgcggcggctatcgtt
ctggcggttgctgcgttgttgatttatcggcgcaggcaggcgtggacggagatgaccggc
gatgccgggttgtcatcgctgccgccggaaacctaccgacagccggtagtgctggtctgt
ggcggtctgtcggcgcacctgttcactgacagcccggtccgccaggtttcagaagggctg
tatctgcatgttcctgatgaagaacagcttgtggcgcaggtggagcgattgctgaccctt
cgcccggcgtgggcatcgcagcttgccgtggcgtataccatcatgcccggcatacaccgg
gatgtggcggttctggccggacggctgcgacggttcgcccacagtatggcgacggtgcgt
cgtcgggcaggcgtaaacgtcccctggcttctctggagcgggctgtccggctcgccgttg
ccggaaagagcgagttcaccgtggtttatctgtaccggcggcgaagttcaggtagcaaca
tccacagagaacgcgatgcccgcgcagtggattgcacaatccggcgtacaggaacgcagt
cagcgactctcttatctgctgaaagccgaaagcctgatgcagtggctggatcttaatgtg
ctggcggaactgaacggcccggaggcgaaatgtccaccactggcgatggccgtggggctg
gtcccctcgttgcctgcggtggataacaacctgtggcagttgtggatcaccgccagaacc
ggcctgacgccggatatcgcggacaccggcacagacgatgcgctgccattcccggatgcc
ctgttacggcggttgccgcgtcagtcgggctttaccccgctgcgacgggcctgcgtgacc
atgctgggcgtcaccaccgtggcgggtatcgccgcgctgtgcctgtcagccacggcaaat
cgccagttattacggcaggtcggtgacgatctgcaccggttttatgccgtcccggtggag
gaatttatcaccaaagcccgtcacctgtcggtgctgaaagacgatgcgaccatgctcgat
gggtattaccgggaaggagaaccactgcgcctcggtctggggttataccccggcgaacgc
atccgccagccggtattacgcgccattcgcgactggcgtccgcctgaacaaaaaatggag
gtgacggcttcgcttcaggttcagaccgtgcgtcttgacagtatgtcgctgtttgacgtc
ggacaggcccgcctgaaagacggctcgacaaaagtgctggtggacgcactggtgaacatc
cgggcaaaaccgggctggctgatcctcgtggccggatataccgatgccaccggcgatgaa
aaaagcaatcagcagttatcgctgcggcgtgccgaagcggtgcgcaactggatgctgcag
accagcgacatcccggccacctgttttgccgtacagggactgggcgagagccagcctgcg
gcgaccaacgacacgccacagggccgggcagtcaaccggcgtgtcgaaatcagtcttgtt
ccgcgttctgacgcctgtcaggacgtgaaataa

DBGET integrated database retrieval system