KEGG   Escherichia coli PMV-1: ECOPMV1_03083
Entry
ECOPMV1_03083     CDS       T02847                                 

Definition
(GenBank) PGAP1-like protein
Organism
ecoi  Escherichia coli PMV-1
SSDB
Motif
Pfam: PGAP1 LCAT Abhydrolase_6
Other DBs
NCBI-ProteinID: CDH66450
Position
3156563..3158332
AA seq 589 aa
MTSTMHMDRADKNKVGTVEIEDLRVIPVIFLPGVMGSNLMDKKGKSIWRYDDSMSLMGWS
LPTSGPKERKRLLHPDRVEVDNRGRIPAPPDAQEKLIQLGQQYPEDPSDKEAMDNYTQAV
RDILDNIEPEAKLFGSRKDRGWGEVANASYGSFLDVLQTALYRDKPTKKGETLSATYQQL
LDVPLGLEYGPDSLDEEYLEVIRLYQFPVHVVGYNWLGSNMLSAIRLQEQIKKIVGGYQK
RGMKCHKVILVTHSMGGLVARYFSECLSGNTDVYGIVHGVLPSIGAAATYTRMKRGTENP
ESNPEGYVISHILGRNAAEMVAVFSQSPGPMELLPMNDYGEEWLNIVDRDGSTLTLPKNL
PIKEGIAPEERTYAELYLNRENWWKLVDENLLNPFNTSLNQKQIDTDWNIYENLITESVN
PFHKQIAGKYHINTYSFYGRAKLGDIPEAHLTQENVLWKGSLSMEKKSDISLEPKFIDGR
LDLNEVGNIRTIKDEFSPEEQAWEINTDDGDTYVKIGQRFTLRDSCENGDGTVPLRAGQI
VHKNILERLAVQVSHEAAYRNPVSQAFALRSIIKIAQEVKKDGKMSYSD
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgacatcgacgatgcatatggacagggccgataagaataaagttggcaccgttgaaatt
gaggatctacgggttattccggttatttttctgcccggagtcatgggttcaaaccttatg
gataagaaaggaaaatccatctggcgatatgatgactctatgagtctgatgggctggtca
ctacctacatcaggaccaaaagagaggaaaagattattgcatcctgacagggtggaggtc
gataatcgtgggagaattcccgcacctccggatgcccaagaaaaacttattcagttaggt
caacaatatccggaggacccatccgataaagaagcaatggataattacactcaggcagta
cgtgacattttggataatatagagccagaagcgaaattatttggttcaagaaaagatcgc
ggctggggagaggttgcaaatgctagctacggttcctttctcgatgtattacaaacagca
ttgtaccgggacaaacctacaaagaaaggtgagacgttaagtgcgacctaccagcaacta
ctcgatgtacctttgggtttggagtatggtcctgactcacttgatgaagagtatcttgaa
gtcataaggttgtatcaatttccggtccatgtcgttggctataactggcttggttctaat
atgctctcagcaatcagactacaagaacagatcaagaaaattgttggaggctatcaaaaa
cgaggaatgaaatgccataaagttattctggttacgcattcaatgggaggactagtggca
aggtacttttcagagtgtctttcggggaatacggatgtctacggtattgttcatggcgta
ttaccatcaattggtgctgcggcgacatatacccgaatgaaacgtggaactgaaaaccca
gagtcaaatccggaagggtatgttatcagtcatatcttaggtcgtaatgcagctgaaatg
gtagctgttttttcccagtcgccaggaccaatggaattactacccatgaatgattatggt
gaagagtggcttaatattgtcgatcgtgatggtagtacattaacgctccctaaaaatctt
cccattaaagaaggtattgcccccgaagaacgcacctacgctgaactttatctaaataga
gaaaattggtggaaattggtggatgagaatctattgaatccttttaatacttcattaaat
caaaagcaaattgatactgattggaatatatatgaaaatttaattactgagagtgtcaat
ccatttcataagcaaattgctggaaaatatcatatcaatacttactctttctatgggaga
gcgaaattgggagatattcctgaagcgcatttaacgcaggaaaatgttctttggaaaggc
tcattatcaatggaaaaaaaaagtgatatatctttagaaccaaaattcattgatggtcgt
cttgatttaaatgaagttggtaacattagaactattaaggatgaattttctcctgaagaa
caggcgtgggaaataaatactgacgacggtgatacatatgttaagataggacagcgtttt
acattacgagactcttgtgaaaacggggatggtacagtacctcttcgtgcaggacaaatc
gtacacaagaacatcctagagcgtttggctgtacaggtttctcacgaggctgcttatcga
aatcccgttagtcaggcatttgcattacgttctattataaaaatagctcaggaggtaaaa
aaggatggtaaaatgtcatactctgattaa

DBGET integrated database retrieval system