KEGG   Escherichia coli O18 K1 PMV-1 (ExPEC): ECOPMV1_03138
Entry
ECOPMV1_03138     CDS       T02847                                 

Gene name
hcrA_1
Definition
(GenBank) 4-hydroxybenzoyl-CoA reductase subunit alpha
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
ecoi  Escherichia coli O18:K1 PMV-1 (ExPEC)
Pathway
ecoi00230  Purine metabolism
ecoi01100  Metabolic pathways
ecoi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecoi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECOPMV1_03138 (hcrA_1)
Enzymes [BR:ecoi01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     ECOPMV1_03138 (hcrA_1)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C DUF4694
Other DBs
NCBI-ProteinID: CDH66502
Position
3221387..3223684
AA seq 765 aa
MEAREATATGESCMRVDAIAKVTGRARYTDDYVMAGMCYAKYVRSPIAHGYAVSINDEQA
RSLPGVLAIFTWEDVPEIPFATAGHAWTLDENKRDTADRALLTRHVRHHGDAVAIVVARD
ELTAEKAAQLVSIEWQELPVITSPEAALAEDAAPIHNGGNLLKQSTMSTGNVQQTIDAAD
YQVQGHYQTPVIQHCHMESVTSLAWMEDNSRITIVSSTQIPHIVRRVVGQALDIPWSCVR
VIKPFIGGGFGNKQDVLEEPMAAFLTSKLGGIPVKVSLSREECFLATRTRHAFTIDGQMG
VNRDGTLKGYSLDVLSNTGAYASHGHSIASAGGNKVAYLYPRCAYAYSSKTCYTNLPSAG
AMRGYGAPQVVFAVESMLDDAATALGIDPVEIRLRNAAREGDANPLTGKRIYSAGLPECL
EKGRKIFEWEKRRAECQNQQGNLRRGVGVACFSYTSNTWPVGVEIAGARLLMNQDGTINV
QSGATEIGQGADTVFSQMVAETVGVPVSDVRVISTQDTDVTPFDPGAFASRQSYVAAPAL
RSAALLLKEKIIAHAAVMLHQSAMNLTLIKGHIVLVERPEEPLMSLKDLAMDAFYHPERG
GQLSAESSIKTTTNPPAFGCTFVDLTVDIALCKVTINRILNVHDSGHILNPLLAEGQVHG
GMGMGIGWALFEEMIIDAKSGVVRNPNLLDYKMPTMPDLPQLESAFVEINEPQSAYGHKS
LGEPPIIPVAAAIRNAVKMATGVAINTLPLTPKRLYEEFHLAGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggaagcgcgggaagcaaccgctacgggtgaatcatgcatgcgcgtcgatgccattgct
aaggtcaccgggcgagcacgatatactgacgattatgttatggcgggcatgtgttacgcg
aaatatgtacgtagccctatcgcacatggttatgccgtaagtattaatgatgaacaagcc
aggagtttgccgggcgtcctggcgatttttacctgggaagatgtgccagaaatcccattc
gccacggcagggcatgcctggacacttgacgaaaacaagcgcgatactgccgatcgtgcc
ctgctaacgcgccatgttcgtcatcatggcgacgccgttgccatcgtcgtggcccgcgat
gaactcacggcagaaaaagcggcgcaattggtcagcattgagtggcaagaattacccgtt
atcacctcgccagaagcggcgctggcagaagacgctgcaccaatccataacggtggcaat
ttactgaaacaaagcacgatgtcgacgggtaatgtccaacaaacaatcgatgccgccgac
taccaggtacaggggcactatcagactcccgttattcaacattgtcatatggaaagcgtg
acatcgctggcatggatggaggataactcgcgaattaccatcgtttccagcacccagatc
ccgcacattgttcgccgcgtggttggtcaggcgctggatattccctggtcatgcgtacga
gtcatcaaaccgtttatcggtggcggttttggtaataaacaggatgtactggaagagcca
atggcagcattcctgaccagcaaacttggcggcattccggtgaaagtttcccttagccgt
gaagagtgtttcctcgcaacccgtacccgccacgcttttactattgacgggcaaatgggc
gtgaaccgcgacggaacattgaaaggttatagtctggatgttctgtctaacaccggcgct
tatgcatctcacgggcactccattgcttctgctggggggaataaagtcgcttacctttat
cctcgttgtgcctacgcttacagttcaaagacctgctataccaacctcccctcggctggt
gcgatgcgtggttatggcgcgccacaagtcgtatttgccgttgagtctatgcttgatgat
gccgcgacagcgttaggtattgatcctgttgaaattcgtttacgcaacgccgcccgcgaa
ggagatgctaatccgctcacgggaaaacgtatttacagcgcagggttgccggagtgtctt
gaaaaaggccggaaaatctttgaatgggaaaaacgccgtgcagagtgccagaaccagcaa
ggcaatttacgtcgtggcgttggcgtcgcctgttttagctacacctctaacacctggcct
gtcggcgtagaaatagcaggcgcgcgcctgttgatgaatcaggatggaaccatcaacgtg
caaagcggcgcgacggaaatcggccagggtgccgacaccgtgttctcgcaaatggtggca
gaaaccgtgggagttccggtcagcgatgtccgcgtaatttcgacacaagacaccgacgtt
acaccattcgaccccggcgcatttgcctcacgtcagagctatgttgccgcgcctgcgctg
cgcagtgcggcactgttattaaaagagaaaatcatcgctcacgccgcagtcatgctacat
cagtcagcgatgaatctgaccctgataaaaggccatatcgtgctggttgaacgaccggaa
gagccgttaatgtcgttaaaagatttggcgatggacgctttctaccaccctgaacgcggc
gggcagctctctgccgaaagctccatcaaaaccaccactaacccacctgcgtttggctgt
acctttgttgatctgacggtcgatattgcactgtgtaaagtcaccatcaaccgcatcctc
aacgttcatgattcgggccatattcttaatccgctgctggcagaaggtcaggtacacggc
ggaatgggaatgggcattggctgggcgctatttgaagagatgatcatcgatgcgaaaagc
ggcgtggtccgtaaccccaatctgctggattacaaaatgccgaccatgccggatctgcca
caactggaaagcgcgttcgtcgaaatcaatgagccgcaatccgcatacggacataagtca
ctgggtgagccacccataattcctgtagccgctgctattcgtaacgcggtgaagatggct
accggtgttgcaatcaatacactgccgctaacgccaaaacgattatatgaagaattccat
ctggcaggattgatttga

DBGET integrated database retrieval system