KEGG   Escherichia coli O18 K1 PMV-1 (ExPEC): ECOPMV1_03140
Entry
ECOPMV1_03140     CDS       T02847                                 

Gene name
ndhS
Definition
(GenBank) Nicotinate dehydrogenase small FeS subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ecoi  Escherichia coli O18:K1 PMV-1 (ExPEC)
Pathway
ecoi00230  Purine metabolism
ecoi01100  Metabolic pathways
ecoi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecoi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECOPMV1_03140 (ndhS)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: CDH66504
Position
3224570..3225049
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGMPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLFLAAWAEGKEIRTLEGEAKGGKLSHVQLAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcgccaggaatgccgctttcggaactactccgagaacaagggcttcttagtgtc
aaacaaggttgctgcgtaggcgaatgcggtgcctgtacggtgctggtcgacggcacagca
atagacagttgcttattccttgcggcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggtggaaaactttctcatgttcaactggcttatgcgaaatccggcgca
gtgcaatgcgggttttgtacgccgggcctgattatggctaccacggcgatgctggcaaaa
ccacgcgaaaaaccattaaccattacggaaattcgtcgtggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system