KEGG   Escherichia coli PMV-1: ECOPMV1_03220Help
Entry
ECOPMV1_03220     CDS       T02847                                 

Gene name
gshB
Definition
(GenBank) Glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
ecoi  Escherichia coli PMV-1
Pathway
ecoi00270  Cysteine and methionine metabolism
ecoi00480  Glutathione metabolism
ecoi01100  Metabolic pathways
Module
ecoi_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:ecoi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ECOPMV1_03220 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ECOPMV1_03220 (gshB)
Enzymes [BR:ecoi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     ECOPMV1_03220 (gshB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: CDH66582
Structure
PDB: 

Position
3311765..3312715
Genome map
AA seq 316 aa AA seqDB search
MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMADLYLINGEARARTRTLSVE
QNYDKWYEFTGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR
DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL
GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG
RGEPRPLTESDWKIARQIGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS
ITGMLMDAIEARLQQQ
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagctcggcatcgtgatggaccccatcgcaaacatcaacatcaagaaagattcc
agtttcgctatgttgctggaagcacagcgtcgtggttacgaacttcactatatggagatg
gccgatctctatttgatcaatggtgaggctcgcgctcgtacccgtactttgagcgtcgaa
cagaactacgataaatggtacgagttcacgggtgagcaggatctgccgctggccgatctc
gatgtgatcctgatgcgtaaagacccgccgtttgataccgagtttatctacgcgacctat
attctggaacgtgccgaagagaaagggacgctgatcgttaacaagccgcagagcctgcgc
gactgtaacgaaaaactgttcactgcctggttctctgacttaacgccagaaacactggtc
acgcgcaataaagcgcagttgaaagcgttctgggaaaaacacagcgacatcattcttaag
ccgctggacggtatgggcggcgcgtcgattttccgcgtgaaagaaggtgatccaaacctc
ggcgtgattgccgaaaccctgactgagcatggcactcgctactgcatggcgcaaaattac
ctgccagccattaaagatggcgacaaacgcgtgctggtagtggatggcgagccggtgccg
tattgcctggcgcgtattccgcaggggggcgaaacccgtggcaatctggctgccggtggt
cgcggtgaacctcgtccgctgacggaaagtgactggaaaatcgcccgtcagattgggccg
acgctgaaagaaaaagggctgatttttgttggtctggatatcatcggcgaccgtctgact
gaaattaacgtcaccagcccaacctgtattcgtgagattgaagcagagtttccggtgtcg
atcaccggaatgttaatggatgccatcgaagcacgtttacagcagcagtaa

DBGET integrated database retrieval system