KEGG   Escherichia coli PMV-1: ECOPMV1_04802Help
Entry
ECOPMV1_04802     CDS       T02847                                 

Gene name
hsdS
Definition
(GenBank) Type I restriction enzyme EcoKI specificity protein
  KO
K01154  type I restriction enzyme, S subunit [EC:3.1.21.3]
Organism
ecoi  Escherichia coli PMV-1
Brite
KEGG Orthology (KO) [BR:ecoi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ecoi02048]
    ECOPMV1_04802 (hsdS)
Enzymes [BR:ecoi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.3  type I site-specific deoxyribonuclease
     ECOPMV1_04802 (hsdS)
Prokaryotic defense system [BR:ecoi02048]
 Restriction and modification system (R-M system)
  Type I R-M system
   ECOPMV1_04802 (hsdS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methylase_S PI3K_C2
Motif
Other DBs
NCBI-ProteinID: CDH68082
Structure
PDB: 

Position
complement(4919157..4920524)
Genome map
AA seq 455 aa AA seqDB search
MSAGKLPEGWEQIEIGDIADVISGGTPKSGVAENFAPSGEGVAWLTPADLSGYKEKYISH
GARDLTTLGYSSCSAKLMPKGTILFSSRAPIGYVAIAANEIATNQGFKSFAFPSDIFPDY
AYYFLRNIRHIAEEMGTGTTFKEISGSSAKTLPFVLVPFAEQKIIAEKLDTLLAQVDSTK
ARLEQIPQILKRFRQAVLGAAVRGKLTEDWRDNSSLSGWREGKLGEFIKKPSYGTSSKSN
KEGLIPVLRMGNLQGGKLDWTDLVYTSDTIEIEKYKLEYNDVLFNRTNSPELVGKTAIYK
SEQPAIYAGYLIRVQCLPDLNPDYLNYHLNSILGRQYCYSVKSDGVSQSNINAQKLIAYP
ITVPPLPEQAEIVRRVEQLFAYADTIEKQVNNALARVNNLTQSILAKAFRGELTAQWRAE
NPELISGENSAAALLEKIKAERAASGGKKASRKKS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgggaaattgccggaggggtgggaacagattgaaataggcgacattgctgat
gtcatctctggtgggacaccaaaatcgggagtcgctgaaaattttgcaccttcgggtgag
ggagtcgcctggcttacgcctgccgatttgagcggttataaagagaaatatatctcacat
ggtgccagagatttaactacactaggctattcctcttgttcagcaaaactaatgcccaaa
ggcactatactttttagtagccgggcaccgattggatatgttgctattgctgcaaatgag
attgcgactaaccagggtttcaaaagttttgcttttccttcagacatttttcctgattat
gcatattactttctccgcaacatcagacatattgcagaggaaatgggcacaggaacaact
tttaaagaaatttctggtagttctgcgaaaacattaccatttgttcttgtaccgtttgcc
gaacaaaaaatcatcgctgaaaaactcgatacgctgctggcacaggtagacagcaccaaa
gcacgtcttgagcaaatcccacaaatcctgaaacgttttcgtcaggcggttctgggtgca
gcggtgagaggaaaactaactgaagactggagagataattcaagcctgtctgggtggaga
gaaggcaaacttggggagtttataaaaaaaccaagttacggaacgtcatctaagtctaat
aaagaaggactcattcctgtattaagaatgggcaatcttcagggaggaaagttggactgg
acggatctagtctatacgtcagataccatagaaattgaaaagtataaacttgagtacaat
gatgtattattcaatcgtacaaatagtcctgaacttgtcgggaaaacagccatatataaa
tcagagcaaccagctatttatgcaggttatttgattagggttcaatgtttacctgattta
aaccctgactatcttaactaccatttaaatagcattttggggagacaatattgctattca
gttaaatctgatggggtcagtcaatcaaatattaatgcacagaaattaattgcataccca
ataactgttcccccccttcccgaacaagctgaaatcgttcgccgcgtcgagcaactcttc
gcctacgccgacacaatagaaaaacaggtcaacaacgccttagcccgcgtcaacaatctg
acgcaatccatcctggcaaaagcgttccgtggtgaactcaccgcccagtggcgggccgaa
aacccggaattaatcagcggtgaaaacagcgccgccgcgttgctggagaaaatcaaagct
gaacgcgcagccagcgggggtaaaaaagcctcgcgtaaaaagtcctga

DBGET integrated database retrieval system