KEGG   Escherichia coli PMV-1: ECOPMV1_04850Help
Entry
ECOPMV1_04850     CDS       T02847                                 

Gene name
nadR_2
Definition
(GenBank) Trifunctional NAD biosynthesis/regulator protein NadR
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
ecoi  Escherichia coli PMV-1
Pathway
ecoi00760  Nicotinate and nicotinamide metabolism
ecoi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecoi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    ECOPMV1_04850 (nadR_2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecoi03000]
    ECOPMV1_04850 (nadR_2)
Enzymes [BR:ecoi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     ECOPMV1_04850 (nadR_2)
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     ECOPMV1_04850 (nadR_2)
Transcription factors [BR:ecoi03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    ECOPMV1_04850 (nadR_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 HTH_31 HTH_19 HTH_26 Citrate_ly_lig CTP_transf_like MMR_HSR1 FAD_syn HTH_37 ABC_tran AAA_29 Dynamin_N
Motif
Other DBs
NCBI-ProteinID: CDH68127
Position
4969828..4971060
Genome map
AA seq 410 aa AA seqDB search
MSSFDYLKTAIKQQGCTLQQVADASGMTKGYLSQLLNAKIKSPSAQKLEALHRYLGLEFP
RQKKTIGVVFGKFYPLHTGHIYLIQRACSQVDELHIIMGFDDTRDRALFEDSAMSQQPTV
PDRLRWLLQTFKYQKNIRIHAFNEEGMEPYPHGWDVWSNGIKKFMAEKGIQPDLIYTSEE
ADAPQYMEHLGIETVLVDPKRTFMSISGAQIRENPFRYWEYIPTEVKPFFVRTVAILGGE
SSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEIALQYSDYDKIALGHAQYIDFAVK
YANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLG
SSVDRKEFQNLLVEMLEENNIEFVRVEEDDYDSRFLRCVELVREMMGEQR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcatttgattacctgaaaactgccatcaagcaacagggctgcactctacagcag
gtagctgatgccagcggtatgaccaaagggtatttaagccagttactgaatgccaaaatt
aaaagccccagcgcacaaaagctggaggcattgcaccgttatttgggacttgaatttccc
cggcagaagaaaacgatcggtgtcgtattcggtaagttttacccgctgcatactggacat
atctaccttatccagcgcgcctgtagccaggttgacgagctgcatatcattatgggtttt
gacgatacccgcgaccgcgcattgttcgaagacagcgccatgtcgcagcagccaaccgtg
ccggatcgtctgcgctggttattgcagacctttaagtatcaaaaaaatatccgcattcat
gcttttaacgaagagggcatggaaccgtatccacacggctgggatgtgtggagcaacggc
atcaaaaagtttatggccgaaaaaggcattcagccggacctgatctacacctcggaagaa
gccgatgcgccgcagtatatggaacatctggggatcgagacggtgctggtcgatccgaag
cgtacctttatgagtatcagcggtgcgcagatccgcgaaaacccgttccgctactgggaa
tatattcctacggaagtgaagccattctttgtgcgtaccgtggcgatcctcggtggtgaa
tcgagcggtaaatccaccctggtaaacaaacttgccaatatcttcaacactaccagtgcg
tgggaatatggtcgtgattatgtcttttcgcacctcggtggcgatgagatcgcgttgcag
tattccgactacgataaaatcgcgctgggacatgcgcaatatattgattttgcagtgaaa
tatgccaataaagtggcgtttatcgataccgattttgtcactacccaggcgttctgcaaa
aagtacgaagggcgtgagcatccgttcgtgcaggcgttgattgatgagtaccgtttcgat
ctggtgatcctgctggagaacaacacgccgtgggtggcggatggtttacgcagcctcggc
agttcggtggatcgcaaagagttccagaacttgctggtggagatgctggaagagaacaat
atcgaattcgtgcgggttgaagaggacgattacgacagccgtttcctgcgctgcgtggag
ctggtgcgggagatgatgggggagcaaagataa

DBGET integrated database retrieval system