KEGG   Escherichia coli JJ1886: P423_03130Help
Entry
P423_03130        CDS       T02896                                 

Definition
(GenBank) alpha-ribazole phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
ecoj  Escherichia coli JJ1886
Pathway
ecoj00860  Porphyrin and chlorophyll metabolism
ecoj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecoj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    P423_03130
Enzymes [BR:ecoj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     P423_03130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 PPTA
Motif
Other DBs
NCBI-ProteinID: AGY83556
Structure
PDB: 

Position
complement(678215..678826)
Genome map
AA seq 203 aa AA seqDB search
MRLWLIRHGETQANVDGLYSGHAPTPLTARGIEQAQNLHTLLHDVSFDLVLCSELERAQH
TARLVLSDRQHPVHIIPELNEMFFGDWEMRHHRDLMQEDAENYSAWCNDWQQAIPTNGEG
FQAFSQRVERFIARLSEYQHYQNILVVSHQGVLSLLIARLIGMPAESMWHFRVDQGCWSA
IDINQKFATLRVLNSRAIGVENA
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgtggttaattcgtcatggtgaaacgcaagcgaatgtcgatggtctgtacagc
ggtcatgcgcccacacccctgaccgcgcgcggtattgagcaagcgcaaaatctgcatacg
ctgctacatgatgtttcctttgacctggttttatgcagtgaactggaacgggcacagcat
accgcgcgactggttcttagtgaccgccagcaccccgttcatatcatccctgaactcaat
gaaatgttttttggcgactgggagatgcgacatcatcgtgacctcatgcaagaagatgcc
gaaaactatagcgcgtggtgcaatgactggcagcaagctatccccacgaacggtgaagga
tttcaggcattttcgcaacgtgtggaacgatttatcgcaaggcttagtgaatatcagcac
tatcagaatattttagtcgtcagccatcagggcgtactgagtctgttaattgctcgttta
attggtatgcctgccgagtctatgtggcatttccgcgttgaccaggggtgttggagcgcc
attgatatcaaccaaaaattcgcgacgctacgcgtcctcaatagccgtgccatcggggtc
gagaatgcatga

DBGET integrated database retrieval system