KEGG   Escherichia coli JJ1886: P423_04320Help
Entry
P423_04320        CDS       T02896                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ecoj  Escherichia coli JJ1886
Pathway
ecoj00260  Glycine, serine and threonine metabolism
ecoj01100  Metabolic pathways
ecoj01110  Biosynthesis of secondary metabolites
ecoj01120  Microbial metabolism in diverse environments
ecoj01130  Biosynthesis of antibiotics
ecoj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ecoj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    P423_04320
Enzymes [BR:ecoj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     P423_04320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 CheD
Motif
Other DBs
NCBI-ProteinID: AGY83756
Structure
PDB: 

Position
complement(914850..915851)
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPSRAMLEAMMAAPVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQ
ANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKI
KPDDIHFARTKLLSLENTHNGKVLPREYLKEAWEFTRERNLALHVDGARIFNAVVAYGCE
LKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMY
ALKNNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVRVGEENAAALGEYMKARNVL
INASPIVRLVTHLDVSREQLAEVAAHWRAFLAR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttacgcagtgataccgttacccgaccgagccgcgccatgctcgaagcgatg
atggccgccccggttggggacgacgtttatggagacgaccctaccgttaatgctctgcag
gactatgcagcagagctttccggtaaagaagccgccatttttctgcctaccggcactcag
gccaacctggtcgctctgctcagtcactgcgaacgcggcgaagagtatatcgtcggtcag
gccgcgcataactatctgtttgaagccggtggcgcagcagtactgggcagtattcagccg
caacccatcgacgcagctgccgacggtacgctaccgctggataaagtggcgatgaaaatc
aaacccgacgatatccatttcgcccgcaccaaattactcagtctggaaaacacccacaac
ggcaaagtgctgccgcgtgaatacctgaaagaagcatgggaatttacccgcgagcgcaat
ctggcgctgcacgttgacggtgcgcgcatttttaatgccgtggtggcttacggctgcgaa
ctgaaagagatcacgcaatattgtgactcgttcaccatttgcctgtcgaaaggtcttggg
acgccagtcggttcattactcgtcggtaatcgtgattacattaaacgtgccattcgctgg
cggaaaatgacaggtggcgggatgcgtcagtccggcattctggctgccgccgggatgtat
gcgctgaaaaataacgtcgcacgtttgcaggaagaccacgataacgccgcctggatggcg
gagcagttgcgtgaagcaggcgcggatgtgatgcgtcaggacaccaatatgctgtttgtt
cgcgtcggggaagaaaatgctgccgcgttaggcgaatacatgaaagcgagaaacgtgctg
attaacgcctcgccgattgtccgcctggtgacccatcttgacgtctcgcgtgaacaactg
gcggaagttgccgcccactggcgtgcgttcctggcgcgttaa

DBGET integrated database retrieval system