KEGG   Escherichia coli JJ1886: P423_08375Help
Entry
P423_08375        CDS       T02896                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
ecoj  Escherichia coli JJ1886
Pathway
ecoj00250  Alanine, aspartate and glutamate metabolism
ecoj00650  Butanoate metabolism
ecoj00760  Nicotinate and nicotinamide metabolism
ecoj01100  Metabolic pathways
ecoj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecoj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    P423_08375
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    P423_08375
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    P423_08375
Enzymes [BR:ecoj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     P423_08375
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     P423_08375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh baeRF_family2
Motif
Other DBs
NCBI-ProteinID: AGY84380
Position
complement(1705885..1707273)
Genome map
AA seq 462 aa AA seqDB search
MTITPATHAISINPATGEQLSVLPWAGVDDIENALQLAAAGFRDWRETNIDYRAEKLRDI
GKALRARSEEMAQMITREMGKPINQARAEVAKSANLCDWYAEHGPAMLKAEPTLVENQQA
VIEYRPLGTILAIMPWNFPLWQVMRGAVPIILAGNGYLLKHAPNVMGCAQLVAQVFKDAG
IPQGVYGWLNADNDGVSQMIKDSRIAAVTVTGSVRAGAAIGAQAGAALKKCVLELGGSDP
FIVLNDADLELAVKAAVAGRYQNTGQVCAAAKRFIIEEGIASAFTERFVAAAAALKMGDP
RDEDNALGPMARFDLRDELHHQVEKTLAQGARLLLGGEKMAGAGNYYPPTVLANVTPEMT
AFREEMFGPVAAITIAKDAEHALELANDSEFGLSATIFTTDETQARQMAARLECGGVFIN
GYCASDARVAFGGVKKSGFGRELSHFGLHEFCNIQTVWKDRV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaccattactccggcaactcatgcaatttcgataaatcctgccaccggtgaacaactt
tctgtgctgccgtgggctggtgttgacgatatcgaaaacgcacttcagctggcggcagca
ggctttcgcgactggcgcgagacaaatatagattatcgtgctgaaaaactgcgtgatatc
ggtaaggctctgcgcgcccgtagcgaagaaatggcgcaaatgatcacccgtgaaatgggc
aaaccaatcaaccaggcgcgcgctgaagtggcgaaatcggcgaatttgtgtgactggtat
gcagaacatggtccggcaatgctgaaggcagaacctacgctggtggaaaatcagcaggcg
gttattgagtatcgaccgttggggacgattctggcgattatgccgtggaattttccgtta
tggcaggtgatgcgtggcgctgttcccatcattcttgctggtaacggctacttacttaaa
catgcgccgaatgtgatgggctgtgcacagctcgttgcccaggtgtttaaagatgcgggt
atcccacaaggcgtatatggctggctgaatgccgacaacgacggtgtcagtcagatgatt
aaagattcgcgcattgctgctgtcacagtgaccggaagtgttcgtgctggagcggctatt
ggcgcacaggctggagcggcactgaaaaaatgcgtactggaactgggtggttcggatccg
tttattgtgcttaacgatgccgatctggaactggcggtgaaagcggcggtagccggacgt
tatcagaataccggacaggtttgtgcagcggcaaaacgctttatcatcgaagagggaatt
gcttcggcatttaccgaacgttttgtggcagctgcggcagccttgaaaatgggcgatccc
cgtgatgaagacaacgctctcggaccaatggctcgttttgatttacgtgatgagctgcat
catcaggtggaaaaaacactggcgcagggtgcgcgtttgttactgggcggggaaaagatg
gctggggcaggtaactactatccgccaacggttctggcgaatgttaccccagaaatgacc
gcgtttcgggaagaaatgtttggccccgttgcggcaatcaccattgcgaaagatgcagaa
catgcgctggaactggctaatgatagtgagttcggcctttcagcgaccattttcaccacc
gacgaaacacaggccagacagatggcggcacgtctggaatgcggtggggtgtttatcaat
ggttattgtgccagcgatgcgcgagtcgcctttggtggcgtgaagaagagtggctttggt
cgtgagctttcccatttcggcttacacgaattctgtaatatccagacggtgtggaaagac
cgggtctga

DBGET integrated database retrieval system