KEGG   Escherichia coli JJ1886: P423_12785Help
Entry
P423_12785        CDS       T02896                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ecoj  Escherichia coli JJ1886
Pathway
ecoj00220  Arginine biosynthesis
ecoj00250  Alanine, aspartate and glutamate metabolism
ecoj00290  Valine, leucine and isoleucine biosynthesis
ecoj01100  Metabolic pathways
ecoj01110  Biosynthesis of secondary metabolites
ecoj01130  Biosynthesis of antibiotics
ecoj01210  2-Oxocarboxylic acid metabolism
ecoj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ecoj00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    P423_12785
   00290 Valine, leucine and isoleucine biosynthesis
    P423_12785
   00220 Arginine biosynthesis
    P423_12785
Enzymes [BR:ecoj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     P423_12785
    2.6.1.66  valine---pyruvate transaminase
     P423_12785
Amino acid related enzymes [BR:ecoj01007]
 Aminotransferase (transaminase)
  Class I
   P423_12785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Aminotran_MocR Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AGY85081
Structure
PDB: 

Position
2600641..2601858
Genome map
AA seq 405 aa AA seqDB search
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPLAPDLLTITFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
TPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccattgaaaaatccagcaaattagagaatgtctgttatgacatccgtggtccg
gtgctgaaagaagcaaaacgcctggaagaagaaggtaacaaggttctgaaactgaacatc
ggcaaccctgccccgttcggttttgacgcgccagatgaaattctcgttgacgtgatacgc
aacctgcctaccgctcaagggtattgcgattccaaaggtctttactccgcgcgtaaagcc
atcatgcagcactaccaggctcgtggcatgcgtgatgttaccgtggaagatatttacatc
ggcaatggtgtatcggagcttatcgttcaggcaatgcaagcattgctgaacagcggggac
gaaatgttggttcctgcacctgattacccactatggaccgcggcggtttcactctccagc
ggtaaagcggtgcattatctttgcgatgaatcctctgactggttcccggacctcgatgat
attcgcgctaaaattacgcctcgtacgcgtgggatcgttattatcaacccaaataaccca
accggcgcggtatattccaaagagcttttaatggagattgtggagattgcacgtcagcat
aatctcattatctttgccgatgaaatttatgacaaaattctctacgacgacgctgagcat
cactccattgcgccgcttgcacctgacctgctgaccattacctttaacggactgtcgaaa
acgtaccgcgttgcaggcttccgtcaggggtggatggtgttgaacgggccgaaaaaacac
gctaaaggttacatcgaaggtctggaaatgctggcttcaatgcgcctgtgtgctaacgtt
cctgcgcaacacgccattcagaccgcactgggtggttatcagagcatcagtgaatttatt
acccctggcggtcgtctttatgagcagcgtaaccgcgcgtgggaattgatcaacgatatt
ccgggcgtttcctgcgtgaaacctcgtggtgcgctgtatatgttcccgaaaatcgacgcc
aaacgctttaacattcacgacgatcagaaaatggtgctggatttcctgttgcaggaaaaa
gtcctgttggtgcaagggacggcattcaactggccgtggccggatcacttccgcattgtc
acgctaccgcgtgtcgatgatatcgagctgtctttgagtaagttcgcgcgtttcctttct
ggttatcatcagctgtaa

DBGET integrated database retrieval system