KEGG   Escherichia coli JJ1886: P423_15740
Entry
P423_15740        CDS       T02896                                 

Definition
(GenBank) xanthine dehydrogenase subunit A
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
ecoj  Escherichia coli JJ1886
Pathway
ecoj00230  Purine metabolism
ecoj01100  Metabolic pathways
ecoj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecoj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    P423_15740
Enzymes [BR:ecoj01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     P423_15740
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AGY85568
Position
3223549..3225846
AA seq 765 aa
MEAREATATGESCMRVDAIAKVTGRARYTDDYVMAGMCYAKYVRSPIAHGYAVSINDEQA
RSLPGVLAIFTWEDVPEIPFATAGHAWTLDENKRDTADRALLTRHVRHHGDAVAIVVARD
ELTAEKAVQLVSIEWQELPVITSSEAALAEDAAPIHNGGNLLKQSTMSTGNVQQTIDAAD
YQVQGHYQTPVIQHCHMESVTSLAWMEDDSRITIVSSTQIPHIVRRVVGQALDIPWSCVR
VIKPFIGGGFGNKQDVLEEPMAAFLTSKLGGIPVKVSLSREECFLATRTRHAFTIDGQMG
VNRDGTLKGYSLDVLSNTGAYASHGHSIASAGGNKVAYLYPRCAYAYSSKTCYTNLPSAG
AMRGYGAPQVVFAVESMLDDAATALGIDPVEIRLRNAAREGDANPLTGKRIYSAGLPECL
EKGRKIFEWEKRRAECQNQQGNLRRGVGVACFSYTSNTWPVGVEIAGARLLMNQDGTINV
QSGATEIGQGADTVFSQMVAETVGVPVSDVRVISTQDTDVTPFDPGAFASRQSYVAAPAL
RSAALLLKEKIIAHAAVMLHQSAMNLTLIKGHIVLVERPEEPLMSLKDLAMDAFYHPERG
GQLSAESSIKTTTNPPAFGCTFVDLTVDIALCKVTINRILNVHDSGHILNPLLAEGQVHG
GMGMGIGWALFEEMIIDAKSGVVRNPNLLDYKMPTMPDLPQLESAFVEINEPQSAYGHKS
LGEPPIIPVAAAIRNAVKMATGVAINTLPLTPKRLYEEFHLAGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggaagcgcgggaagcaaccgctacgggtgaatcatgcatgcgcgtcgatgccattgct
aaggtcaccgggcgggcacgatatactgacgattatgttatggcgggcatgtgttacgcg
aaatatgtacgtagccctatcgcacatggttatgccgtaagtattaatgatgaacaagcc
aggagtttgccgggcgtcctggcgatttttacctgggaagatgtgccagaaatcccattc
gccacggcagggcatgcctggacacttgacgaaaacaagcgcgatactgccgatcgtgcc
ctgctaacgcgtcatgttcgtcatcatggtgacgccgttgccatcgtcgtagcccgcgat
gaactcacggcagaaaaagcggtgcaattggtcagcattgagtggcaagaattacccgtt
atcacctcgtcagaagcggcgctggcagaagacgctgcaccaatccataacggtggcaat
ttactgaaacaaagcacgatgtcgacgggtaatgtccaacaaacaatcgatgccgccgac
taccaggtacaggggcactatcagacgcccgttattcaacattgtcatatggaaagcgtg
acatcgctggcatggatggaggatgactcgcgaattaccatcgtttccagcacccagatc
ccgcacattgttcgccgcgtggttggtcaggcgctggatattccctggtcatgcgtacga
gtcatcaaaccgtttatcggtggcggttttggtaataaacaggatgtactggaagagcca
atggcggcattcctgacaagcaaacttggcggcattccggtgaaagtttctcttagccgt
gaagagtgtttcctcgcaacccgtacccgccacgcttttactattgacgggcaaatgggc
gtgaaccgcgacggaacattgaaaggttatagtctggatgttctgtctaacaccggcgct
tatgcatctcacgggcactccattgcttctgctggggggaataaagtcgcttacctttat
cctcgttgtgcctacgcttacagttcaaagacctgctataccaacctcccctcggctggt
gcgatgcgtggttatggcgcgccacaagtcgtatttgccgttgagtctatgcttgatgat
gccgcgacagcgttaggtattgatcctgttgaaattcgtttacgcaacgccgcccgcgaa
ggagatgctaatccgctcacgggaaaacgtatttacagcgcagggttgccggagtgtctt
gaaaaaggccggaaaatctttgaatgggaaaaacgccgtgcagagtgccagaaccagcaa
ggcaatttacgtcgtggcgttggcgtcgcctgttttagctacacctctaacacctggcct
gtcggcgtagaaatagcaggcgcgcgcctgttgatgaatcaggatggaaccatcaacgtg
caaagcggcgcgacggaaatcggccagggtgccgacaccgtgttctcgcaaatggtggca
gaaaccgtgggagttccggtcagcgatgtccgcgtaatttcgacacaagacaccgacgtt
acaccattcgaccccggcgcatttgcctcacgtcagagctatgttgccgcgcctgcgctg
cgcagtgcggcactgttattaaaagagaaaatcatcgctcacgccgcagtcatgctacat
cagtcagcgatgaatctgaccctgataaaaggccatatcgtgctggttgaacgaccggaa
gagccgttaatgtcgttaaaagatttggcgatggacgctttctaccaccctgaacgcggc
gggcagctctctgccgaaagctccatcaaaaccaccactaacccaccggcgtttggctgt
acctttgttgatctgacggtcgatattgcactgtgtaaagtaaccatcaaccgcatcctc
aacgttcatgattcgggccatattcttaatccgctgctggcagaaggtcaggtacacggc
ggaatggggatgggcattggctgggcgctatttgaagagatgatcatcgatgcgaaaagc
ggcgtggtccgtaaccccaatctgctggattacaaaatgccgaccatgccggatctgcca
caactggaaagcgcgttcgtcgaaatcaatgagccgcaatccgcatacggacataagtca
ctgggtgagccacccataattcctgtagccgctgctattcgtaacgcggtgaagatggct
accggtgttgcaatcaatacactgccgctaacgccaaaacgattatatgaagaattccat
ctggcaggattgatttga

DBGET integrated database retrieval system