KEGG   Escherichia coli JJ1886: P423_15750
Entry
P423_15750        CDS       T02896                                 

Definition
(GenBank) xanthine dehydrogenase subunit C
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ecoj  Escherichia coli JJ1886
Pathway
ecoj00230  Purine metabolism
ecoj01100  Metabolic pathways
ecoj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecoj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    P423_15750
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AGY85570
Position
3226732..3227211
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLFLAAWAEGKEIRTLEGEAKGGKLSHVQLAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgctggtcgacggcactgcg
atagacagttgcttattccttgcggcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggtaaactttctcatgtccaactggcttatgcgaaatctggtgca
gtgcaatgcgggttttgtacgccgggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgtggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacaaagtaa

DBGET integrated database retrieval system