KEGG   Escherichia coli JJ1886: P423_21510Help
Entry
P423_21510        CDS       T02896                                 

Definition
(GenBank) NADH-dependent gamma-hydroxybutyrate dehydrogenase
  KO
K08318  4-hydroxybutyrate dehydrogenase / sulfolactaldehyde 3-reductase [EC:1.1.1.61 1.1.1.373]
Organism
ecoj  Escherichia coli JJ1886
Pathway
ecoj00650  Butanoate metabolism
ecoj01100  Metabolic pathways
ecoj01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ecoj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    P423_21510
Enzymes [BR:ecoj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.61  4-hydroxybutyrate dehydrogenase
     P423_21510
    1.1.1.373  sulfolactaldehyde 3-reductase
     P423_21510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 NAD_binding_11 F420_oxidored 2-Hacid_dh_C 3HCDH_N UDPG_MGDP_dh_N IlvN TrkA_N Sacchrp_dh_NADP ApbA
Motif
Other DBs
NCBI-ProteinID: AGY86527
Position
4421134..4422012
Genome map
AA seq 292 aa AA seqDB search
MATIAFLGLGQMGSPMANNLLQKGHSLQVFDVNTQAVDALVTQGATAAQTPAEAAASAEF
IITMLPNGDIVRQVLLGEKGVCETVSSDALVIDMSTIHPLQTDALIRELQEKGINMMDAP
VGRTSVNAIDGTLLILAGGTDEQIARARPILMCMGNELVEAGGPGMGIRVKLINNYMSIA
LNALSSEAAVLCESLGLNLDVAIKVMSGTAAGKGHFTTTWPGKVLKGDLSPAFMVDLALK
DLRIAVDVARKTGAPLNMGIAAESYYAAASQDGKGRQDWSALLNQVRQQAGL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccattgcatttctcgggctggggcagatgggtagcccaatggctaacaatcta
ttgcaaaaagggcattcattacaggtatttgatgtcaatacacaggccgtcgatgcgcta
gttacgcagggggccactgcggcacaaaccccagcggaagcggcagcaagcgctgaattt
atcatcactatgcttcccaatggggacattgttcgacaggtgctgttgggggaaaaaggc
gtctgtgaaactgtttcatctgacgcgttagtgattgatatgtcgactattcatccctta
cagaccgatgcattaatacgggaattacaagaaaaaggcatcaatatgatggacgccccc
gtgggcagaacgtcagtgaatgcgattgatggcacattgctgattttagcgggcggcact
gatgagcagattgcgcgtgcacgcccgattctcatgtgcatgggtaatgagctggtcgag
gctggtggcccaggaatggggatccgcgtgaagctaattaacaactatatgagcattgcg
cttaatgcgctgtcctccgaagccgctgtgttatgtgagtcactgggattaaatcttgat
gtcgcaattaaggtgatgagtggtacggcagcagggaaaggacattttacgaccacctgg
cctggcaaagtgctgaaaggcgatctttctcccgccttcatggtggacctggcattgaaa
gatctgcgtattgcagttgacgtcgctcggaaaacgggggcgccgctcaatatggggatt
gcagcagaaagttattacgccgcagcaagtcaagacggcaaagggcggcaggactggagc
gccctgctaaatcaggttcgccagcaggctggtctttaa

DBGET integrated database retrieval system