KEGG   Escherichia coli K-12 MDS42: ECMDS42_0273Help
Entry
ECMDS42_0273      CDS       T02541                                 

Gene name
mhpF
Definition
(GenBank) acetaldehyde-CoA dehydrogenase II, NAD-binding
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
ecok  Escherichia coli K-12 MDS42
Pathway
ecok00360  Phenylalanine metabolism
ecok00362  Benzoate degradation
ecok00620  Pyruvate metabolism
ecok00621  Dioxin degradation
ecok00622  Xylene degradation
ecok00650  Butanoate metabolism
ecok01100  Metabolic pathways
ecok01120  Microbial metabolism in diverse environments
ecok01220  Degradation of aromatic compounds
Module
ecok_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ecok00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECMDS42_0273 (mhpF)
   00650 Butanoate metabolism
    ECMDS42_0273 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    ECMDS42_0273 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECMDS42_0273 (mhpF)
   00622 Xylene degradation
    ECMDS42_0273 (mhpF)
   00621 Dioxin degradation
    ECMDS42_0273 (mhpF)
Enzymes [BR:ecok01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ECMDS42_0273 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh F420_oxidored GFO_IDH_MocA Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: BAL37581
Position
299110..300060
Genome map
AA seq 316 aa AA seqDB search
MSKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVI
GLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTPAAIGPYCVPVVNLEAN
VDQLNVNMVTCGGQATIPMVAAVSRVARVHYAEIIASIASKSAGPGTRANIDEFTETTSR
AIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDIEASINEMAEAVQAYVPGY
RLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAHYLPAYAGNLDIMTSSALAT
AEKMAQSLARKAGEAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcgtaaagtcgccattatcggttctggcaacattggtaccgatctgatgatt
aaaattttgcgtcacggtcagcatctggagatggcggtgatggttggcattgatcctcag
tccgacggtctggcgcgcgccagacgtatgggcgtcgccaccacccatgaaggggtgatc
ggactgatgaacatgcctgaatttgctgatatcgacattgtatttgatgcgaccagcgcc
ggtgctcatgtgaaaaacgatgccgctttacgcgaagcgaaaccggatattcgcttaatt
gacctgacgcctgctgccatcggcccttactgcgtgccggtggttaacctcgaggcgaac
gtcgatcaactgaacgtcaacatggtcacctgcggcggccaggccaccattccaatggtg
gcggcagtttcacgcgtggcgcgtgttcattacgccgaaattatcgcttctatcgccagt
aaatctgccggacctggcacgcgtgccaatatcgatgaatttacggaaaccacttcccga
gccattgaagtggtgggcggcgcggcaaaagggaaggcgattattgtgcttaacccagca
gagccaccgttgatgatgcgtgacacggtgtatgtattgagcgacgaagcttcacaagat
gatatcgaagcctcaatcaatgaaatggctgaggcggtgcaggcttacgtaccgggttat
cgcctgaaacagcgcgtgcagtttgaagttatcccgcaggataaaccggtcaatttaccg
ggcgtggggcaattctccggactgaaaacagcggtctggctggaagtcgaaggcgcagcg
cattatctgcctgcctatgcgggcaacctcgacattatgacttccagtgcgctggcgaca
gcggaaaaaatggcccagtcactggcgcgcaaggcaggagaagcggcatga

DBGET integrated database retrieval system