KEGG   Escherichia coli K-12 MDS42: ECMDS42_0274Help
Entry
ECMDS42_0274      CDS       T02541                                 

Gene name
mhpE
Definition
(GenBank) 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase, class I
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
ecok  Escherichia coli K-12 MDS42
Pathway
ecok00360  Phenylalanine metabolism
ecok00362  Benzoate degradation
ecok00621  Dioxin degradation
ecok00622  Xylene degradation
ecok01100  Metabolic pathways
ecok01120  Microbial metabolism in diverse environments
ecok01220  Degradation of aromatic compounds
Module
ecok_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ecok00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    ECMDS42_0274 (mhpE)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECMDS42_0274 (mhpE)
   00622 Xylene degradation
    ECMDS42_0274 (mhpE)
   00621 Dioxin degradation
    ECMDS42_0274 (mhpE)
Enzymes [BR:ecok01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     ECMDS42_0274 (mhpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: BAL37582
Position
300057..301070
Genome map
AA seq 337 aa AA seqDB search
MNGKKLYISDVTLRDGMHAIRHQYSLENVRQIAKALDDARVDSIEVAHGDGLQGSSFNYG
FGAHSDLEWIEAAADVVKHAKIATLLLPGIGTIHDLKNAWQAGARVVRVATHCTEADVSA
QHIQYARELGMDTVGFLMMSHMTTPENLAKQAKLMEGYGATCIYVVDSGGAMNMSDIRDR
FRALKAELKPETQTGMHAHHNLSLGVANSIAAVEEGCDRIDASLAGMGAGAGNAPLEVFI
AAADKLGWQHGTDLYALMDAADDLVRPLQDRPVRVDRETLALGYAGVYSSFLRHCETAAA
RYGLSAVDILVELGKRRMVGGQEDMIVDVALDLRNNK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtaaaaaactttatatctcggacgtcacattgcgtgacggtatgcacgccatt
cgtcatcagtattcgctggaaaacgttcgccagattgccaaagcactggacgatgcccgc
gtggattcgattgaagtggcccacggcgacggtttgcaaggttccagctttaactatggt
ttcggcgcacatagcgaccttgaatggattgaagcggcggcggatgtggtgaagcacgcc
aaaatcgcgacgttgttgctgccaggaatcggcactattcacgatctgaaaaatgcctgg
caggctggcgcgcgggtggttcgtgtggcaacgcactgtaccgaagctgatgtttccgcc
cagcatattcagtatgcccgcgagctcggaatggacaccgttggttttctgatgatgagc
catatgaccacgccggagaatctcgccaagcaggcaaagctgatggaaggctacggtgcg
acctgtatttatgtggtggattctggcggtgcgatgaacatgagcgatatccgtgaccgt
ttccgcgccctgaaagcagagctgaaaccagaaacgcaaactggcatgcacgctcaccat
aacctgagtcttggcgtggcgaactctatcgcggcggtggaagagggctgcgaccgaatc
gacgccagcctcgcgggaatgggcgcgggcgcaggtaacgcaccgctggaagtgtttatt
gccgccgcggataaactgggctggcagcatgggaccgatctctatgcgttaatggatgcc
gccgacgacctggtgcgtccgttgcaggatcgaccggtacgagtcgatcgcgaaacgctg
gcgctgggatacgctggtgtttactcgagcttcctgcgtcactgtgaaacggcggcggcg
cgttatggcttaagtgcggtggatattctcgttgagctgggcaaacgccggatggttggc
ggccaggaggatatgatcgttgacgtggcgctggatctgcgcaacaacaaataa

DBGET integrated database retrieval system