KEGG   Escherichia coli K-12 MDS42: ECMDS42_0847Help
Entry
ECMDS42_0847      CDS       T02541                                 

Gene name
agp
Definition
(GenBank) glucose-1-phosphatase/inositol phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
ecok  Escherichia coli K-12 MDS42
Pathway
ecok00010  Glycolysis / Gluconeogenesis
ecok01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECMDS42_0847 (agp)
Enzymes [BR:ecok01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     ECMDS42_0847 (agp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: BAL38132
Structure
PDB: 

Position
919802..921043
Genome map
AA seq 413 aa AA seqDB search
MNKTLIAAAVAGIVLLASNAQAQTVPEGYQLQQVLMMSRHNLRAPLANNGSVLEQSTPNK
WPEWDVPGGQLTTKGGVLEVYMGHYMREWLAEQGMVKSGECPPPYTVYAYANSLQRTVAT
AQFFITGAFPGCDIPVHHQEKMGTMDPTFNPVITDDSAAFSEQAVAAMEKELSKLQLTDS
YQLLEKIVNYKDSPACKEKQQCSLVDGKNTFSAKYQQEPGVSGPLKVGNSLVDAFTLQYY
EGFPMDQVAWGEIKSDQQWKVLSKLKNGYQDSLFTSPEVARNVAKPLVSYIDKALVTDRT
SAPKITVLVGHDSNIASLLTALDFKPYQLHDQNERTPIGGKIVFQRWHDSKANRDLMKIE
YVYQSAEQLRNADALTLQAPAQRVTLELSGCPIDADGFCPMDKFDSVLNEAVK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaacgctaatcgccgcagctgtggcagggatagttttactcgcttcaaacgct
caggcacaaaccgtaccggaaggctatcagctacagcaagtgctcatgatgagccgccat
aacttacgtgcgccgctggcgaacaatggcagtgtgctggagcagtcgacgccgaataaa
tggccagaatgggacgtccccggtgggcaactcaccaccaaaggtggcgtgctcgaagtg
tatatgggccattacatgcgtgaatggctggcagagcaggggatggtgaaatcgggggaa
tgcccgccgccgtacaccgtttatgcctatgccaatagtctgcaacgtaccgttgcgacc
gcacagttctttattaccggcgcattcccggggtgtgatattcctgtgcatcaccaggaa
aaaatgggcactatggacccaacctttaacccggtgatcaccgatgattccgccgcattc
agtgaacaggcggtggcggcaatggagaaagagctcagcaaactccagcttaccgacagc
taccagctactggaaaaaatcgttaactataaagattcccctgcctgtaaagagaaacaa
cagtgttcgctggtggatggcaaaaatacctttagcgccaagtatcaacaagaaccaggt
gtttccgggccgctgaaagtcggcaactcgctggtagatgcgtttactttgcaatattac
gaaggttttccgatggatcaggtggcctggggagaaatcaaatctgaccagcagtggaag
gtgttgtcgaagcttaaaaacggctaccaggacagcctgtttacctcaccggaagtggcg
cgcaatgttgcgaaaccgctggtcagttatatcgacaaagctctggtcaccgatcgcacc
agcgcaccgaaaattacagtgttggttgggcacgactccaacattgcctctctgttaacg
gcgctggatttcaaaccgtatcagttgcatgaccagaacgaacgcacgccgattggcggc
aaaatcgttttccagcgttggcatgacagcaaagccaatcgcgatttgatgaaaattgaa
tatgtgtatcagagtgcggaacagttacgtaatgccgatgcgttaaccctgcaggcacct
gcgcagcgtgtgacgctggaattaagcggttgcccgatagacgctgatggtttctgcccg
atggataagtttgatagcgtgttgaatgaagcggtgaaataa

DBGET integrated database retrieval system