KEGG   Escherichia coli K-12 MDS42: ECMDS42_1095Help
Entry
ECMDS42_1095      CDS       T02541                                 

Gene name
puuA
Definition
(GenBank) gamma-Glu-putrescine synthase
  KO
K09470  gamma-glutamylputrescine synthase [EC:6.3.1.11]
Organism
ecok  Escherichia coli K-12 MDS42
Pathway
ecok00330  Arginine and proline metabolism
ecok01100  Metabolic pathways
Module
ecok_M00136  GABA biosynthesis, prokaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:ecok00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    ECMDS42_1095 (puuA)
Enzymes [BR:ecok01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.11  glutamate---putrescine ligase
     ECMDS42_1095 (puuA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gln-synt_C Gln-synt_N_2
Motif
Other DBs
NCBI-ProteinID: BAL38361
Position
complement(1163719..1165137)
Genome map
AA seq 472 aa AA seqDB search
METNIVEVENFVQQSEERRGSAFTQEVKRYLERYPNTQYVDVLLTDLNGCFRGKRIPVSS
LKKLEKGCYFPASVFAMDILGNVVEEAGLGQEMGEPDRTCVPVLGSLTPSAADPEFIGQM
LLTMVDEDGAPFDVEPRNVLNRLWQQLRQRGLFPVVAVELEFYLLDRQRDAEGYLQPPCA
PGTDDRNTQSQVYSVDNLNHFADVLNDIDELAQLQLIPADGAVAEASPGQFEINLYHTDN
VLEACDDALALKRLVRLMAEKHKMHATFMAKPYEEHAGSGMHIHISMQNNRGENVLSDAE
GEDSPLLKKMLAGMIDLMPSSMALLAPNVNSYRRFQPGMYVPTQASWGHNNRTVALRIPC
GDRHNHRVEYRVAGADANPYLVMAAIFAGILHGLDNELPLQEEVEGNGLEQEGLPFPIRQ
SDALGEFIENDHLRRYLGERFCHVYHACKNDELLQFERLITETEIEWMLKNA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaatatcgttgaagtagagaactttgttcagcagtcagaagagaggcggggt
agcgcctttacgcaggaagtgaaacgctacctggagcgctacccgaatacgcaatatgtt
gatgttttacttaccgatttaaatggttgcttccgtggaaagcgtattcctgtttcaagc
ctgaagaagctcgagaaagggtgttatttcccggcctcggtatttgcaatggatattctg
ggcaacgtagtagaagaagcaggtctgggtcaggaaatgggcgagccggatcgtacctgt
gttcctgttctcggttccttaactccttctgccgccgatccagagtttatcggtcagatg
ctcctgaccatggtcgatgaagatggcgctccctttgacgttgagccgcggaacgttctt
aaccgcctgtggcagcagctgcgccagcgcggattgttcccggtcgtagcggtagagctg
gagttctatttactggatcgccagcgcgacgctgaagggtatctgcaaccgccctgcgcg
cctggcaccgatgaccgcaatacacaaagccaggtttactccgttgataacctcaaccac
ttcgccgacgtgctcaatgatattgatgaactggcgcagttacagctgattccggcagat
ggcgcggtcgctgaggcctcgccgggtcagtttgaaatcaacctttaccatactgataac
gtgctggaagcctgcgatgatgcgctggcactaaaacgcctggtgcgtctgatggcagaa
aagcataagatgcacgccacttttatggcgaagccgtatgaagagcacgcgggcagcgga
atgcatatccatatcagtatgcaaaataatcgtggcgagaacgtgctttctgacgcggaa
ggcgaagattcgccgctgctgaaaaagatgctcgccgggatgattgacctgatgccgtcg
tcgatggcgttgctggcaccaaacgtgaactcgtatcgccgcttccagccgggaatgtat
gtgccgacgcaggcgtcgtggggccataacaaccgcaccgtcgccctgcgtattccgtgc
ggcgaccgtcataatcaccgcgtggaatatcgcgtggcgggtgccgatgccaacccatat
ctggtgatggcagcgatttttgccggtattttgcatggccttgataacgagctgccgttg
caggaagaagtcgaaggcaacgggctggaacaggaaggcttaccctttccgattcgccag
agcgatgccctgggtgagtttatcgagaatgatcacctgcgccgctatttaggcgaacgc
ttctgccatgtctatcacgcctgtaaaaatgatgagctgttgcagtttgagcgcctcatc
acagaaacagaaattgagtggatgttgaaaaacgcgtaa

DBGET integrated database retrieval system