KEGG   Escherichia coli K-12 MDS42: ECMDS42_1634Help
Entry
ECMDS42_1634      CDS       T02541                                 

Gene name
hisD
Definition
(GenBank) bifunctional histidinal dehydrogenase/histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ecok  Escherichia coli K-12 MDS42
Pathway
ecok00340  Histidine metabolism
ecok01100  Metabolic pathways
ecok01110  Biosynthesis of secondary metabolites
ecok01230  Biosynthesis of amino acids
Module
ecok_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ecok00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    ECMDS42_1634 (hisD)
Enzymes [BR:ecok01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     ECMDS42_1634 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh FdhE
Motif
Other DBs
NCBI-ProteinID: BAL38865
Structure
PDB: 

Position
1713625..1714929
Genome map
AA seq 434 aa AA seqDB search
MSFNTIIDWNSCTAEQQRQLLMRPAISASESITRTVNDILDNVKARGDEALREYSAKFDK
TTVTALKVSAEEIAAASERLSDELKQAMAVAVKNIETFHTAQKLPPVDVETQPGVRCQQV
TRPVASVGLYIPGGSAPLFSTVLMLATPASIAGCKKVVLCSPPPIADEILYAAQLCGVQD
VFNVGGAQAIAALAFGTESVPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPAADMARRVAEAVERQLAELPRAETARQ
ALNASRLIVTKDLAQCVEISNQYGPEHLIIQTRNARELVDSITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKEGFSALASTIETLAAAERLTAHK
NAVTLRVNALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaacacaatcattgactggaatagctgtactgcggagcaacaacgccagctg
ttaatgcgcccggcgatttccgcctctgaaagcattacccgcactgttaacgatattctc
gataacgtgaaagcacgcggcgatgaggccctgcgggaatacagcgcgaagtttgataaa
accacggttaccgcgctgaaggtgtctgcagaggagatcgccgccgccagcgaacgcctg
agcgacgagctaaaacaggcgatggcggtggcagtaaagaatattgaaaccttccacact
gcgcaaaaactgccgccggtagatgtagaaacgcagccaggcgtgcgttgccagcaggtc
acgcgtccggtagcttcagttgggttgtatattcctggcggctccgccccgctcttctca
acggtattaatgctggcgactccggcgagtattgcgggctgtaaaaaagtggtgctgtgc
tcaccgccgccgattgccgatgagatcctttatgcggcgcagctgtgcggtgtgcaggac
gtgtttaacgtcggcggcgcacaggccattgccgcactggcgtttggtacggaatctgtg
ccaaaagtggacaaaatcttcgggccgggtaacgcctttgtcaccgaagcgaaacgtcag
gtgagccagcgtctggacggtgcggcgatcgatatgcccgcaggcccgtcggaagtgctg
gtgattgctgacagcggcgctacgccggatttcgtggcttctgatttgctctctcaggct
gaacacggcccggactcacaggtgattttactgacgcccgctgctgatatggcgcgtcgc
gttgccgaggccgtcgaacgccaactggcagaactgccgcgtgccgaaaccgcccgccag
gcactgaacgccagccgcctgatcgtgactaaagatttagcgcagtgcgtggagatctcc
aaccagtacggcccggagcacctgatcattcagacccgcaacgcccgtgaactggtcgat
agcatcaccagcgccggttcggtatttcttggtgactggtcaccggaatcggcaggtgat
tacgcctccggcaccaaccacgttctaccgacttacggttacaccgccacctgttccagc
ctcgggctggcagatttccagaagcgcatgaccgtacaggaactgtcgaaagaggggttc
tccgcgctggcttcaaccatagaaacactggccgccgccgagcgcctgaccgcccacaaa
aatgccgttactttgcgtgttaacgcccttaaggagcaagcatga

DBGET integrated database retrieval system