KEGG   Escherichia coli K-12 MDS42: ECMDS42_1661Help
Entry
ECMDS42_1661      CDS       T02541                                 

Gene name
baeS
Definition
(GenBank) sensory histidine kinase in two-component regulatory system with BaeR
  KO
K07642  two-component system, OmpR family, sensor histidine kinase BaeS [EC:2.7.13.3]
Organism
ecok  Escherichia coli K-12 MDS42
Pathway
ecok02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecok00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ECMDS42_1661 (baeS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ecok01001]
    ECMDS42_1661 (baeS)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ecok02022]
    ECMDS42_1661 (baeS)
Enzymes [BR:ecok01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     ECMDS42_1661 (baeS)
Protein kinases [BR:ecok01001]
 Histidine kinases
  OmpR family
   ECMDS42_1661 (baeS)
Two-component system [BR:ecok02022]
 OmpR family
  BaeS-BaeR (envelope stress response)
   ECMDS42_1661 (baeS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_5 betaPIX_CC
Motif
Other DBs
NCBI-ProteinID: BAL38890
Position
1749083..1750486
Genome map
AA seq 467 aa AA seqDB search
MKFWRPGITGKLFLAIFATCIVLLISMHWAVRISFERGFIDYIKHGNEQRLQLLSDALGE
QYAQHGNWRFLRNNDRFVFQILRSFEHDNSEDKPGPGMPPHGWRTQFWVVDQNNKVLVGP
RAPIPPDGTRRPILVNGAEVGAVIASPVERLTRNTDINFDKQQRQTSWLIVALATLLAAL
ATFLLARGLLAPVKRLVDGTHKLAAGDFTTRVTPTSEDELGKLAQDFNQLASTLEKNQQM
RRDFMADISHELRTPLAVLRGELEAIQDGVRKFTPETVASLQAEVGTLTKLVDDLHQLSM
SDEGALAYQKAPVDLIPLLEVAGGAFRERFASRGLKLQFSLPDSITVFGDRDRLMQLFNN
LLENSLRYTDSGGSLQISAGQRDKTVRLTFADSAPGVSDDQLQKLFERFYRTEGSRNRAS
GGSGLGLAICLNIVEAHNGRIIAAHSPFGGVSITVELPLERDLQREV
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctggcgacccggtattaccggcaaactgtttctggcgattttcgccacctgc
attgtcttgctgatcagtatgcactgggcggtgcgtatcagttttgagcgtggctttatt
gattacatcaagcatggtaatgaacagcgattacaactgttaagtgatgcgcttggcgag
cagtatgcgcagcatggcaactggcgcttcctgcgcaacaatgatcgctttgtctttcag
atcctgcgttcatttgaacacgataattcggaagataaacccggcccgggtatgccaccg
cacggctggcgtacccagttctgggtggttgatcaaaacaacaaagtgctggttggtccg
cgagcgccgattccacctgacggtacacggcgacccattctggtcaacggtgcggaagtt
ggcgcggtgatcgcctcccccgttgagcggttaacgcgcaatactgatatcaatttcgat
aaacaacagcggcaaaccagctggttgattgtcgccctggcaacgttactcgcggcactt
gccacttttctgctggcgcgcggtttactggcaccggtaaaacgacttgtcgatggcacg
cacaaactggcggcgggcgatttcactacccgcgtaacgcccaccagtgaagatgaactg
ggcaaactggcgcaagacttcaaccagcttgccagcacactggagaaaaaccagcaaatg
cggcgcgattttatggccgatatttctcacgaactgcgtacgccattagcggtgctgcgc
ggtgaactggaagccattcaggatggcgtgcgtaaattcacgccggagacggtggcgtct
ttacaggcggaggtcggtacactgaccaaactggttgacgatctccatcagttgtcgatg
tctgatgaaggcgctctcgcctatcaaaaagcaccggtagatttgatcccactgctggaa
gtggcgggcggcgcatttcgcgaacgattcgccagtcgtggcctgaaactgcaattttcc
ctgccagacagtattaccgtatttggcgatcgcgaccgtttaatgcagttattcaataac
ttactggaaaacagcctgcgctacactgacagcggcggcagcctgcaaatctctgccggg
cagcgcgacaaaacggtgcgcctgacctttgccgacagtgcgccaggtgtcagtgacgat
cagctacaaaaattgtttgaacgtttttatcgcaccgaaggttcccgcaaccgtgccagc
ggcggttccgggctggggctggcgatttgcctgaacattgttgaagcacataatggtcgc
attattgctgcccattcgccttttggcggggtaagcattacagtagagttaccgctggaa
cgggatttacagagagaagtatga

DBGET integrated database retrieval system